621PA

Three-dimensional structures of h-ras p21 mutants: molecular basis for their inability to function as signal switch molecules
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGHEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of H-ras p21 mutants: molecular basis for their inability to function as signal switch molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oncogene protein
molecule keywords H-RAS P21 PROTEIN
total genus 56
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 1991-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 621pA00
1N6HA 2ZJZA 3L8ZA 4B6EA 3VKGA 1Z2CA 1G64A 3S1AA 1JAIA 3X1DA 1W46A 4DEYA 4EIWA 3AVTA 2PMDA 4JSYA 2OG2A 3PCRB 3BB4A 2Q9CA 4K81B 3EARA 4P4SB 4YXWD 1XBTA 1U0LA 2WAXA 2VH5R 3BK7A 4KITB 2FFBA 5HZHA 1Z3IX 4C0LA 1N2CE 1P75A 2DY1A 1EX7A 3ZIAD 1Z22A 3FGNA 4B73A 4DCNA 4AYTA 1UPTA 3H0KA 3T12A 5KTYA 1EFRA 2PT5A 4NBSA 4NE2A 5C18A 4B3GA 5B30A 1L7VC 2AK3A 4DDTA 5DN6D 5DHAA 4CEIA 1TUEA 3K0EA 3MMPA 4EFLA 1DO2A 2OSBA 4PSKA 2CL6X 3K0AA 1GWNA 1K8RA 3IHLA 4M1WA 4H9GA 5CITA 4Q00A 4JMPA 3T1TA 4GPTA 3EIEA 2ODBA 2ZUDA 3P4YA 2CE2X 3AVXA 3X1WA 2BBSA 3KXIA 3RDPA 3RC3A 1W36C 1M7HA 2XAUA 4URYR 1XTRA 1LV7A 1OHHA 1GL7A 1KSJA 1IN7A 1Z07A 2FSGA 1X8KA 2ZRIA 3TUZC 3GLFB 3ZVMA 5JJIA 1T9HA 1Z06A 3HDTA 4WAUA 2JGNA 5TVKA 3KXLA 2HXSA 3O8BA 3U60B 5EQTA 2V54A 4DBLC 1AIPA 4LHZA 5JCZA 2QSZA 1F60A 3SDZA 4R98A 2ZJAA 1IBRA 3OE7D 5FI0B 4Z8XA 3TNFA 1YZTA 4GL2A 2NO7A 2ZXUA 2I4IA 1T8TA 4PQYA 2WJJA 1F2TB 5L3VA 1G18A 1Q44A 2HJGA 4WXRA 4GNKA 1MH1A 1MR3F 3ZH9B 3QBTA 1SHKA 3VKWA 1LNZA 3EZ6A 1GFIA 2CHGA 2IYZA 3VR4A 3KQUA 4N0DA 2VP6A 2QL6A 5FR1A 1NLZA 4D4LA 2BBWA 2QZ4A 5JRJA 1IONA 4QGHA 2P65A 4M9SA 2CCJA 3SR0A 3BH0A 3R9WA 3U4QA 4A92A 1G6HA 2WJYA 3EG5A 3NG1A 2D62A 2ZRBA 3KKNA 2GCOB 4Z8YA 2ZTSA 1SKYB 1TU4A 3WMFA 4BECA 2P3SA 2CJWA 4C2TA 3PITA 3TK1A 4YDHB 1XD9A 4TYNA 2Z43A 5DI3A 2OBLA 3NHAA 5FPKA 2ZI4A 2DWPA 4TYQA 3IEVA 1TQ2A 3HYTA 4ITRC 3OIVA 1IN8A 2VHUA 1G4AE 3EZFA 1KAOA 1W2HA 4QHYA 4CW7A 4LYHA 3THYB 1BOFA 2XZOA 2WIAA 4MUBA 2F1JA 2PZGA 2QM7A 1EFHA 2ASEA 1EX6A 1OFHA 1WP9A 4Z51A 4URWR 4MGZR 4LJAA 4C2UA 5CDFE 3K70B 3IHWA 3VFDA 2RGXA 1ZNYA 1OJLA 1P9RA 2B21A 3LRPA 5JJKA 3CIOA 1M7BA 1SQ5A 1NJGA 5LD2C 3SJAA 1E9CA 3EPHA 1DAEA 3K0FA 4RZ2A 2HJVA 4RVCA 4Q7KA 1G3MA 1HE8B 4IVPA 1K6MA 4XTRA 3B1YA 3CWZA 3L0SA 2AD1A 4NDZA 2NPFA 1YHNA 2OLKA 3GLGA 1Y3AA 1ZM7A 2ERYA 1QHIA 2JLUA 4Q5IA 2GXQA 3RS4A 3JVUA 1UKZA 1WMSA 3FVQA 3K0AB 4FCVA 2BMEA 4O0MA 4TL7A 3IIJA 4OQLA 5CDFA 4B3DA 4C4PA 3K9GA 1Z6YA 3QEJA 2NZ8A 5B2ZA 5KNCA 4LWZA 2QUZA 4G0NA 8OHMA 3BAFA 1OW3B 3ZVLA 4Q19A 3RYTC 5B58C 5JFGA 5HE8A 5CK4A 4L9WA 5K8UA 3BH6A 3EZ9A 1G1MA 4BRUA 4DEXA 2PLRA 2VP5A 2RHMA 1BKDR 1W4AA 4EPTA 3R8CA 2GZHA 4QG7A 1D6JA 2G1KA 4P4SA 3SNHA 1JXMA 3TKLA 5DO9A 3QXSA 4A0RA 3DPUA 5JRZA 1GL9B 1C1YA 5D3MB 5DN6A 4D0NA 2J46A 2R65A 1KDTA 2ZRNA 1IHUA 2ZSFA 3W3ZB 4QNMA 4PFSA 4TZ6A 3IPXA 1U9IA 2ZQ5A 4JLMA 3C7KA 4DWJA 1A4RA 1W2GA 2A3RA 3B7GA 3I73A 3GJXC 3H84A 4WVFA 5DLQC 3RWMB 2GCNA 1AS2A 2P2LA 3TIFA 5IDVA 2PH1A 1E2FA 2QTFA 3HYRA 4HUQB 4M22A 4M2LA 4YLGA 4KLNA 3SJZA 2HYIC 1KDOA 2VQSA 2R6FA 2PJRA 1KTVA 1TUIA 4FMDF 1RVDA 4AURA 2C96A 1VCIA 4QGGA 1QRAA 5A4JA 5DSZA 4YMSA 1NVWQ 4MGYR 4RD4A 2QT1A 1AM4D 1BMFD 4IOLA 4Q18A 1NY6A 1DO0A 2OE2A 3H1TA 1TTTA 1DOAA 1JR3E 2RGDA 3NEJA 5C46F 4ZKEA 1A1VA 4D26A 5CYOA 4TL6A 5FOWA 1SVSA 2VHTA 3VR6A 2R8RA 2EVWX 2QGZA 1G8FA 2CVHA 3DHWC 2FU5C 4Q02A 3GLFA 4G1UC 1JXOA 1M8PA 5G41A 3M0EA 5HE9A 3L43A 3OAAA 3AVUA 1WRBA 1QVAA 4KO8A 4ON9A 4URXR 4HZUB 1U8YA 4JLAA 1P61B 1S96A 2J0VA 1IAQA 4M1MA 2O5VA 2BJVA 3PV0A 1ZNWA 5HR5A 4DLSA 2JJ1D 4QBGB 4U7DA 3A6PC 1ZM9A 3SJBA 3PUXA 5FOXA 1Q1ZA 2ODNA 1NVXQ 3B1WA 1IY2A 1Z63A 2AL7A 2WMOB 2ZJ5A 1FX0B 4HZIA 121PA 1ZNXA 4POAA 4PPGA 3SYLA 4BFVA 1KSHA 3OEED 1US8B 4M9QA 4UJ3A 3V9PA 4DUGA 1R4AA 3KFXA 4FD2A 4N1AA 4BZPA 3GLIE 1DAFA 1NSFA 3W6OA 2GXAA 2H57A 2QN6A 1WXQA 3J81k 3P32A 1UBGA 3OE7A 2F9MA 2ZS8A 3L82B 1TEVA 2EWWA 4OBEA 1J2JA 3LBNA 1W0KD 3T1VA 3GJ6A 3S1AB 4D25A 1FFHA 2Z4RA 2ECKA 3B6EA 1SXJD 3FMPB 3SE0A 1XCGB 2FEMA 2N1BA 1KY3A 5FBQB 1UAAA 2GEVA 1CTQA 2MMCA 3B8HA 1QG4A 3GLIB 2HT6A 2QE7D 3RRNA 1V5WA 4NL4H 1ZVQA 1RRCA 2CEAA 1P9NA 4Q01A 3QXHA 1I4DD 3MUFA 2WVJA 2V8OA 4JVLA 2J45A 1U94A 3WMEA 1ZM4A 2C9YA 3LWNA 2QROA 3UXMA 1QHYA 2R9VA 3D3QA 5JS8A 1G7CA 4ZDKA 2AWOA 1MO5A 1XD2A 4JYCA 5KDOA 1S2MA 3T15A 5J4LA 1G7TA 3RNLA 1OXVA 3L8YA 2UZIR 4PANA 1AGPA 3CUEF 4QM6A 2HLDD 2GAOA 3EA0A 2GWHA 1KSGA 4LJ4A 1HY3A 2QTVB 4Q4JB 4US2R 5J4KA 2W2XA 5H8WA 2W2VA 1UF9A 2BJWA 1TAGA 3C16C 3UATA 1FMJA 2FGKA 5J4HA 2VA8A 2JIZD 1KY2A 4JJKA 2CVFA 4NCHA 4RY2A 4Q7LA 3LW7A 1EXMA 5LD2B 1KKLA 3OF5A 2PCLA 3CX7A 3LBIA 4B2PA 4B47A 4OK3A 1ZP6A 5FUVA 5KNDA 4L9SA 2A5DA 1ZIOA 1LY1A 2ZEJA 3WHKA 2KB0A 1KHTA 1XD2B 1DAKA 1NBMD 1SXJB 2MMGA 3EXAA 1JQJC 2QMEA 4BFXA 2QP9X 3LQRA 2W58A 1BYUA 5H1YA 1DTSA 1U90A 5KPDA 1H8EA 1J8YF 3FFAA 3KTAA 1E1RA 1KOFA 4UJ5A 2PX0A 2GAAA 4C0SA 1QF9A 2FH5B 1JR3D 2GHIA 1T3LA 1V43A 4EPYA 2WICA 4MKFA 4PPFA 3SHWA 1VYVA 2BVNA 2WWXA 3AQ4A 2NPIA 4P31A 2QTHA 4Y0AA 5D3MA 4DSNA 2BM1A 1ESNA 2OV2A 2OAP1 3U2QA 1GG2A 4OHYA 3WNCA 3MJRA 3VMFA 3QPUA 4XWKA 1EWRA 1MOZA 4C7OA 1U8AA 3B13B 1KI3A 1KYIA 1F6BA 1M6NA 2YHSA 2PBRA 3DM9B 2VSXA 3B2EA 3UMFA 5KSOA 2KWIA 1XF9A 3K0CA 4AKIA 1VG9B 1W49A 2VP2A 2VRWA 3DMNA 1KJWA 2GF0A 2PCJA 4R2IA 4B6FA 3HP1A 1FMLA 4RSGA 5LB4A 1JALA 1KI2A 1TMKA 4ESVA 2NO9A 2JASA 3HWSA 4LPSA 4EJSA 1H8HA 1GRQA 4B3FX 2RMKA 1S3SA 2BKEA 4JLJA 1SXJC 2A5FA 3W3AA 1ZYUA 3PUYA 4JL8A 3TSWA 3AVVA 2C2HA 3FKQA 3CRMA 5SZKB 3FOZA 3DM5A 1HURA 1ZD1A 1MV5A 1OKKA 1N5KA 4BEBA 3VX3A 1VMAA 3NEYA 2IEZA 3B9PA 4FW9A 4LK2A 2W6IA 3NBFA 1UM8A 2Z4SA 4Y0VA 4C0QC 3LBHA 4XD7D 4PO1A 3KX2A 5CLLA 1VIYA 3IIMA 1SVIA 5CYPA 1G7RA 1KK2A 4A0HA 1AK2A 2H16A 5JSZA 1BMFA 2NZJA 4LI0A 3CF2A 1FZQA 2HCJB 3RS3A 1S8FA 4TT3A 4B75A 4QGAA 5HTKA 2QORA 3PXGA 3GLIA 1Z2AA 4OQMA 4B74A 1G5PA 4OJKA 1UEIA 3F5FA 4ZCLA 2C5LA 3IUYA 4Q1EA 1E79A 2ZS9A 1KZGB 3SFZA 2BCGY 3UPUA 3P20A 5FTJA 1NSTA 2DWQA 4ERNA 2BKUA 3OAAD 1L4YA 2X1VA 1Z6AA 2G1JA 3E2IA 4MRVA 5F9HA 2G6BA 1DAMA 4DB2A 1S9DA 2ZYUX 3E5HA 1SVOA 1E69A 1C9KA 2JATA 4D2IA 4PAQA 1NMZA 2JJ1A 3ND8A 1KAGA 4XSGA 3FHOA 3HPRA 3TQFA 3WP0A 2FFHA 4QHSA 4XVRA 2IS1A 4A0GA 5KHOC 5AJWA 1FX0A 2GK6A 2QQ0A 1RW4A 3L0IB 2ZRDA 3MCAA 4A15A 1KDPA 1VHTA 3BRWD 1I2MA 1R5BA 1OXSC 2ZJBA 3I1FA 4NH0A 1Y63A 3Q5DA 3QVUA 3LW8A 2GEUA 3GJ8A 5G3YA 2ZR7A 4LY6A 4FXPA 2QQEA 1Z83A 5CLQA 4NCJA 2AXNA 2GA8A 3GEHA 3AVWA 2IS4A 5IHPA 3B82A 2QAGA 2B7CA 3NH6A 4PHTA 2Z0MA 2I1VB 3EWSA 3PJRA 4MDFA 1Z29A 2ZSAA 3ZVNA 2DBYA 2IXEA 3HU1A 5EXXA 4P0TA 1G9XA 1P7CA 2YJTD 1JJVA 1SXJA 4LV6A 3RWOA 621PA 2P6RA 2ZSEA 1RE0A 4F38A 3L0PA 1XEXB 5IK2D 1LF0A 1T4GA 4ASUA 4M1OA 4D4JA 3NC0C 5HKKD 3CRRA 3CPEA 2J7KA 4KV9A 4DDUA 3TH5A 2GVZC 2F1IA 1XPUA 1COWA 2WOOA 3THWB 2WPDD 4NONA 4HUTA 1TF5A 3IEUA 1IY0A 3JVVA 4FMCF 1WB9A 5FOVA 2EYUA 1GP2A 3ZQJA 4DLYA 4JT4A 2YC2C 1OH7A 2GEDA 3TJZA 3TLXA 3FTQA 1XNJA 4GI7A 3K0FB 2F55A 1FL9A 2IL1A 1UBFA 4M1TA 1WBBA 1X8LA 3CWQA 1MO3A 1P72A 3UG7A 2HLDA 2RAPA 3OZXA 1QHSA 2KSQA 4LJYA 2WJHA 4IOJA 3IO5A 4KAXA 1KO8A 3THXA 3X1ZA 2ZYVX 4AC9A 4DLWA 2GETA 5BWMA 4YC7A 1E3MA 4LC1A 2BMJA 2GBLA 5JI2E 2AX4A 3CRW1 2XNSA 5FL3A 1ZU5A 4NYIR 1W0JA 2ATVA 2VTKA 1Q57A 1BO6A 2QAJA 3CBQA 3RRYA 4BZQA 2ZVQX 2NQ2C 3TRFA 5DI3B 2OHFA 1RFLA 4OHVA 4LUCA 1P2SA 4ZI3A 4WOPA 1U9IC 4B3CA 4F7WA 1OFTA 2ZREA 4Q4HB 5EP1A 3TBKA 3CH4B 4RKFA 3WY9A 4ZDIA 1SHZA 5JZVA 4DHEA 1CF4A 1CJKC 1S1MA 5GADl 1IXRC 1P5ZB 3AV0B 4G5SA 2W2TA 4BFZA 3TGPA 1Q21A 2F1RA 3LNCA 1T0HB 2OCYC 4UQOA 4BWYA 5TB5A 1AGRA 2Q0HA 1QHXA 1YVDA 4LHWA 3AP3A 1MRSA 3Q5EA 5EE5B 4MKIA 4IVRA 4GT1A 1G20E 4DCUA 1BS1A 1X1SA 2REBA 2VL7A 5B57C 4JVSB 3ASYA 3U6BA 3ZD7A 5FOUA 2Z6VA 5HCIA 2QPAA 2AFIE 3Q72A 3PIRA 2QMHA 1CJTC 4FCTA 1CR4A 3KJHA 4BLTA 4TTPA 4DSUA 1E2EA 1HA3A 3HR8A 1UDXA 2BBTA 4C0AC 3AVOA 2P6UA 3PEYA 3QJYA 3EZ2A 1YZKA 1CJVC 3KQNA 3HR7A 1E9BA 2JJ8A 3BBPA 3MWYW 1JPNA 2FPKA 4JBYA 1P73A 1IN6A 1EGAA 2G0TA 1XXHA 4Q7MB 4BEJA 4X8MA 4N0EA 4JLNA 1KIMA 3I8SA 4IXMA 1NLYA 3IQXA 1UBEA 4W9MC 5EUQB 4NCIA 3O8CA 1DS6A 3AB3A 2IXFA 3IBYA 2Y8EA 2W0MA 4IFBA 2VYFA 1OKKD 2HCBA 3QSYA 2MSCB 1T5IA 3AUXA 1XEWX 5CM9C 4BASA 1NNEA 4H1VA 1OH8A 1G6OA 3TSOA 2JDID 5CM8B 1R8QA 4EDHA 4EFNA 4WZBE 3ZLJA 1JEEA 3KQHA 5TV2A 1DELA 2O8DA 4HAWA 4KBGA 3QG1A 4OHXA 2XOKD 4IVQA 3WYFA 1NY5A 3Q85A 5F98A 1II8B 1QG2A 1AJEA 4JL5A 1I4TD 3CO5A 2FJUA 3QKUA 4XIGS 4MRPA 4Q66C 3W90A 4A36A 2J41A 1ZC3A 4TLCA 1W5SA 2ZRAA 2GJSA 4HATA 4HB3A 4NU0A 4URZR 4HLUC 2O8BB 4O2LA 2J7PA 1YR6A 4X8LA 2XZLA 2J9RA 2UKDA 3B9QA 3RSOA 1E9FA 5BN3A 1R7RA 1VPLA 1YZLA 2WKQA 2REXB 1XDBA 2ZSBA 1VCOA 2AHOA 2E1RA 2YC4C 1TL7C 4LJ6A 1JNYA 5CJ2A 3U7FB 4V0NA 1IXSB 4KVGA 1PVOA 1OF1A 4YXWA 3SJCA 4QL3A 4CIDA 2D2FA 2H92A 5GJCA 1NVVQ 4M1KA 1YZUA 5AUPB 4XTCS 2GK7A 5E4FA 1T8UA 1F5NA 3IQWA 3V4RA 4Z54A 3E1SA 2ZS7A 2OFOA 3SFVA 3FMIA 4IKEA 4TTQA 1M1YE 2C95A 4DSTA 4CEIB 1P4SA 1OB2A 2A5GA 2OXCA 1K5DA 4Q7JB 2F6RA 4LJ9A 2PJZA 5FPTA 1RKBA 1G8YA 4L5BA 3CNLA 3DZDA 5IK2A 4PC2A 1TNDA 4YONB 4IW3B 3I4LA 1PZNA 1NI3A 1O87A 3EIHA 2WBLC 2Q9AA 3F8TA 2X19A 4KJZA 4RD6A 3QVVA 4BLRA 3PEUA 4MRRA 5KUTA 3FKSA 1P6XA 2R44A 2OT3B 4JSTA 4BFUA 3EWAA 3I8XA 4CVNA 2XB2A 2P5TB 3SOPA 4KYUA 1YRBA 1E2PA 1IJFA 1KKMA 3LFUA 1NLFA 3ZZTA 1KZ7B 1E1QA 3M4YA 3GD7A 4NTZA 1ZNZA 3CX6A 3TUJC 1FQKA 4I1SA 4OKSA 4C9BA 2G88A 1KK0A 4PPNA 3AKYA 2ZPTX 1U8ZA 1VCNA 2A78A 1FP7A 1G21E 1HYQA 3NHBA 4PXAA 4W5WA 3KB2A 5SZIA 5EUMA 1UDWA 1KK1A 3R9IA 3AVYA 1P60A 5BYKA 1X1RA 2REOA 2FV8A 2ZRKA 2GVDC 2RGGA 1D9XA 3PEVA 1ZM2A 3A4MA 3WP1B 1VG0B 1D8TA 1R0ZA 2Q3FA 5FOTA 4P4UA 2VSOA 4GMXA 2QMOA 1QHNA 5AWFC 1PLKA 3GLHA 1NVVR 2WSMA 2P0EA 4MKHA 3GLGE 4IOKA 2IA5A 4KLZA 3ICQB 1D2EA 2DFKB 4JVNA 3WRYC 1Z6TA 2H1LA 4E03A 2ZJ2A 2EU8A 3CPHA 4KVAA 4XWOA 2W0SA 3K0SA 1OH5A 3BIFA 4FIDA 2JLSA 4IEIA 4D4MA 2IHBA 2CCKA 4NCNA 4DVGA 2ODEA 2XNDD 5TDHA 3THOA 4IDQA 5LDDC 4EQ6A 3SBDA 5JS7A 5TXGA 3G5UA 4NYJQ 5A5GA 3PFIA 1KI6B 1OV4A 1VG8A 2OAQ1 3OESA 1E2IA 1GRRA 1NMXA 3EX7C 5JMTA 3GJ5A 3QXCA 4FN5A 2ZITA 2ONKA 1XZQA 1HQCA 2ZRHA 3VR2A 2F9LA 5IT5A 1M34E 2QPTA 2DWOA 3PVSA 2FZLA 2R6AA 1OPXA 4HB0A 4PZYA 3T5DA 1SZPA 1PJRA 2AXPA 1GITA 1N5JA 1Z0AA 3CRVA 4FWIB 3MAAC 4RD2A 1F2UB 2IYSA 3GLHE 5DH9A 2HDNB 1XD8A 2FPMA 5DISB 4EFMA 5FR2A 1E96A 1T6NA 2KBEA 4OQXA 4UXHA 1DARA 1Z0JA 3Q9LA 1IOZA 4B32A 1J99A 2V4ZA 1R10A 3W8RA 2RGAA 5CJPA 1ZU4A 1IN5A 3KKMA 3LDAA 2O8EB 2NIPA 3U7HB 4V0MA 3X1XA 4MDEA 3K9LA 2WZQA 1FUUA 2F43A 2PMKA 5KNBA 2WKRA 4BFTA 2WJGA 5JWRA 3AH8A 3MLEA 5FI1B 3AUYA 4NPHA 4Q9HA 2DB3A 3VR3A 5E95A 3LO5A 1J7KA 3PR1A 3N70A 4KXFB 2X2FA 5IRCD 5M04A 2VHQA 1M7GA 2HXYA 1OB5A 1AZTA 1XCMA 2H17A 3R7WA 2OCAA 3TMKA 1XB2A 4RCYA 3SU8A 1E9EA 4MH0R 3I62A 3U5ZB 3OFNA 4Q9LA 3A37A 4L15A 5AUNB 5L3SA 2VP9A 1XEFA 4AY2A 1ZRHA 1G8PA 2EFDB 1GKYA 2PL3A 1CR2A 3LX8A 3T35A 3C4JA 2J1LA 2Z5FA 3QOFA 2O8CA 4GP6A 3BB3A 2ZROA 1KI4A 1ZUIA 4OI4A 3SHFA 4MYTA 5EE3A 1RJ9A 1E9DA 2A5YB 5FTMA 4TL9A 2DFNA 2VIIA 1JR6A 2OZEA 5TMPA 1Z8FA 5FBWB 4ZIRB 4LJ8A 5FL7D 1KSFX 2ZRMA 4LHYA 5DIFA 2QP4A 3MGCA 4ZDJA 3PUZA 1VYUA 1MRNA 5TARA 2V1UA 2IK8A 4K46A 4UXJA 821PA 1Q3TA 4MYHA 1XPRA 3DOFA 4NYMR 3R7WB 2ZSDA 4KSBA 2VPPA 1NL3A 3AGPA 3O47A 4TMZA 2ZI6A 2J59A 1CULC 4AKEA 1Q1BA 5KPJA 4X8HA 1QHHA 1KI1A 3TVDA 1NVUQ 1CJUC 3QENA 1MO4A 2CNWA 3RS0A 1MABA 1IM2A 1Q1EA 1R8SA 2IW3A 3GMTA 3NDPA 4LZZA 5EZ6B 4R9UC 3VTKA 2C99A 4YMVA 1II9A 3EA5A 4DC9A 2P67A 5FFMA 2D3WA 4CEJB 1NMYA 4ZCMA 3QKTA 1I2DA 1DAHA 1G41A 1GL6A 1NN3A 3K9HA 1II8A 1ZUHA 1LVGA 4GOXA 2IYRA 4AYXA 1RRGA 1E6CA 4TN1A 1HTWA 4ZI2A 3GLFE 4A8JB 3T61A 4UNPA 2CJWB 3B5JA 2X77A 3IILA 4TQ9A 5HZKA 4LPKA 4QXAA 3SYKA 2UZ3A 3HJNA 3K8YA 3OEEA 4BLSA 1VECA 3FPAA 3I32A 2XNDA 1CBUA 3KZ1E 4U02A 1IJEA 3RSLA 2PT7A 4DRZA 4EPXA 2LKDA 1VYTA 3U4QB 3VKHA 1AS3A 1SVWA 2B6HA 2F1HA 2JLZA 1AQYA 2VF7A 4MGKR 2XXAB 1OSNA 2VLIA 1G5TA 3GFTA 1MO6A 4I1OA 4AG5A 3RC8A 2WWFA 2FPLA 2K5UA 2YOHA 2YZ2A 4R7ZA 1HE1C 3AVQA 2A2ZA 2WSSA 4TLBA 5FBLB 1ZCAA 2ONJA 1E0JA 4D82A 2QA5A 1MABB 1KI6A 3ADDA 1SKQA 1LS1A 3W6NA 3KQLA 5EXPA 3QBVA 2VF8A 3SC3A 4HAZA 3I3SR 5GVRA 2NMVA 2C03A 3SQXA 1TEXA 3LAWA 1ZCBA 2DFTA 1X6VA 2AWNA 2CL0X 4II7A 2GKSA 5L3QB 2O8FA 5CB6A 1N5LA 2YWGA 3W8NA 1GM5A 2ZR9A 4W5JA 2B92A 1E2KA 4CEHB 3ADKA 4W7SA 4M21A 3GFOA 1W44A 4LDJA 4J0QA 3R20A 3BB1A 1YKSA 2WHXA 2GJ8A 4YMUA 2AR7A 2L0XA 4TYPA 4ZCIA 1G16A 3WBJA 1EFRD 5P21A 2B8TA 1OLOA 1UBCA 1ONBA 2XJ9A 2LCFA 4LOAA 5JHHB 1CP2A 1KNQA 521PA 1H65A 1JB1A 5GJWC 3K70D 1P2TA 4RFSB 2Q21A 4TLDA 5KU1A 4UKDA 2N42A 1OHHD 3I61A 3CW2A 3U44B 2E9SA 4NP6A 2JLQA 4KU4A 3B78A 4DT1A 4PQRA 2OLJA 5BQ5A 5EZ5A 4QJ3A 3KKOA 3CZPA 2R6CA 5JWOA 2LKCA 3RS7A 1RPZA 3ECCA 4OL0A 4DLXA 5KYKA 3DMDA 5JWHA 2XEXA 4NYMQ 4I1VA 3LLUA 3QUSA 3UWKA 3I72A 3O8DA 4QJ4A 2V9PA 4LJ5A 1N6NA 4A1FA 1WQ1R 3F0TA 3U7GA 1SULA 4Q1BA 1SVKA 1DG3A 3L2OB 1VIAA 2G3YA 2ZE8A 5AJXA 4AYWA 2D2EA 2ZJOA 1OXXK 4F4IA 2BIFA 1E2NA 1FUKA 1NKSA 4U00A 2OFWA 3K53A 2BV3A 3KUDA 4NCKA 2VP4A 2IYQA 3NVAA 4MGIR 3PUWA 2YWEA 3LVQE 3ETLA 4QBFA 4AD8A 3OEHA 1S9HA 3AF4A 4PZZA 3Q7PA 4O25A 4PPQA 3QPVA 4DJTA 3Q8XB 3AF1A 1NIPA 1WF3A 1NF3A 2ZE5A 5KO2A 4M9XA 1F48A 1XRJA 3FFBA 2MSEB 2NG1A 3OIUA 1O3YA 2WWIA 4NYIQ 1E2MA 1FNNA 2HF9A 3HPQA 2JEOA 5C1BA 5J5CA 2JLWA 1I4LD 3T1OA 2FX3A 4BGDA 3NTUA 1OIVA 2C78A 2J0UA 3M6AA 3VU9A 2ZRFA 3W9YA 1LS6A 1A2KC 3HU3A 4TZ0A 3W5JA 5AUQA 2ZJ8A 2FE4A 5J40A 2XB4A 3AKEA 2IYUA 1B0UA 4RZUA 4EKDA 4QC2A 3QF4A 1R5OA 3A1SA 4P32A 4LYFA 2CHVA 3RRZA 2CE7A 2G0NA 4PTLA 4KODA 4C0HA 4MA4A 5E3HA 1XWIA 4Q4AB 2OM2A 2WSSD 3VHXA 1Z08A 3MFYA 4Q9KA 1Z6GA 1XTQA 3T34A 2TMKA 4UNRA 4YMTA 3LQQA 3JZAA 5FTNA 1G3IA 5HKKA 2IWHA 1R0XA 2C77A 3SBEA 5FPHA 2GCPA 2D7CA 2XITA 3MWLA 1CR1A 1COWD 1CEEA 2WPDA 3WRXC 2IT1A 3KUCA 4Q47A 1J90A 1T3SA 3ICEA 4GOKA 1WDTA 3NC1C 2JLVA 4HSEA 3QY0A 1D2MA 4KFTA 4WIAA 4C0JA 3C14C 2WM9B 1AZSC 1Z0IA 3CM0A 3IIKA 5CIQA 3BFXA 4D80A 1AS0A 2BHRA 2IS6A 3WHLA 4ZDWA 1QZXA 1ETUA 4HAYA 4IDHA 5BN5A 1KI8A 2P6NA 4B48A 1FOEB 1MKYA 2CLCX 4Q21A 2AK2A 1GTVA 2QNRA 3TQCA 1FW6A 1IQPA 5JBQA 3BFKA 3BH7A 3UIEA 1DPFA 1L2TA 1GNRA 3EZ7A 4EAQA 1NG9A 1GVNB 3FYHA 2I3BA 2BEKA 1NG1A 2IS2A 3ZJYA 2V6IA 3RHFA 3QEOA 1KDRA 4OYHA 3FMOB 4B2IA 3AKDA 4LV8B 1PLLA 3RANA 4ARZB 1XJ0A 4DXAA 5A0FA 3GJ7A 1Z5ZA 4RD0A 3P26A 4DUGD 1U81A 4A6XA 2IHYA 5H70A 4G5QA 3GJ4A 1DG1G 1FTNA 2CBZA 1EFUA 3NKVA 2IF2A 4JBXA 2VSFA 3T1QA 1NN0A 1ZIPA 3AF2A 1E2JA 2ZU0C 3ND9A 1UKVY 1CKEA 3ZZUA 4HLQB 1GZSA 4LX0A 4R71A 2IYLD 3SI7A 3DKVA 5JJLA 2EWVA 3BXZA 2G9NA 3PQCA 4FINA 5KDDA 3CLVA 4WXPA 3ZZ0A 4A8JA 3GPLA 2XZPA 1AQUA 4JLOA 4CF7A 3EC1A 3FWYA 1DAGA 4IEEA 1G3RA 1Z6XA 2ERXA 3NBYC 3DEFA 2FOLA 2W00A 3IKJA 2ZANA 1SKYE 5AR1A 2IYYA 2VO1A 5C4GB 2BCJQ 2IBMA 3KFVA 3LV8A 5AUOB 2WWHA 2DFLA 1HUQA 4G5RA 1W36B 4LSGA 4EPWA 1SGWA 3WNBA 1JAHA 4LYJA 3NDBB 1JEDA 1E0KA 4TMKA 2FN4A 1S1CA 2ZYTX 1F2UA 1LW7A 2RGCA 3CF0A 4RCZA 3THWA 3SYNA 4B71A 2CCGA 4GP7A 2A7QA 4E07A 4CDGA 1FTSA 2R6DA 2JIZA 2C04A 3UG6A 1SXJE 2JDIA 2R6GA 2IYXA 5AJVB 3UANA 2WWGA 3DOEA 1WCV1 4GRAA 4IHQA 5SZJA 4DIDA 3TAUA 5L3SB 3VX4A 4NHOA 4HYYA 5L3QA 2O8FB 2ZI7A 4TMVA 4AIIA 1KMHA 3B1ZA 2XTZA 5H68A 2MSDB 1CU1A 2VP0A 2JAQA 5G53C 2O8CB 4JKIA 5J4VA 4BLPA 4M9ZA 5GJBA 3ZS8A 3MWKA 2RCNA 3R9XA 1CXZA 2DHRA 2GTPA 2V7QD 3SEAA 3CNOA 2IYTA 5SZHB 2XJ4A 1GDDA 4V03A 3WNDA 5LBIA 5L8VA 2KBFA 4D4KA 3EPJA 2HT1A 1W47A 3GEIA 2J7PD 4B34A 4KSCA 1JR3A 3PENA 2WOJA 4JLPA 2RHDA 3REFA 1HT2E 4B35A 1VG1A 1XMSA 3A1UA 4HAUA 4I4LA 2BMDA 4S35A 3I92A 4OQFA 2RB4A 4N3NA 5C4MA 3R8FA 2ZM5A 3B60A 2W6JA 2O8DB 1TF7A 2F3TA 1A7JA 2JLXA 1OIWA 1Z28A 3P4XA 3QI2A 4W5HA 2A30A 4Q1DA 3N2IA 2CL7X 3QQ5A 5GJVC 1LTQA 3DDCA 3LH5A 5EJEA 4Q4HA 1Z0FA 3GJ0A 4LBYA 3OIYA 1WBDA 1E2LA 5AJYA 2EW1A 3SN6A 2WJVA 1H8HD 4TMTA 1XP8A 4PC3A 1W0KA 3OFND 4L16A 4AK9A 4KBFA 4QJ5A 2RGNA 1A2BA 3MSXA 4FMCB 1JBKA 3IBGA 4JS0A 4PQFA 2O0HA 4XOIA 5FBRB 4C0KA 1X8JA 2FWRA 2FSHA 1Q0UA 4QM7A 3DKPA 3AEZA 3FHCB 3O8RA 2D06A 3LX5A 3A8TA 1H8ED 4WW0A 4BFWA 2V55B 2J0QA 1E1RD 1AKEA 5JCPA 4CEHA 1ZMXA 4BFSA 1GSIA 1GKUB 1J8MF 1T91A 2CXXA 3VR1A 1U0HC 4ACBA 4XD7A 3AKCA 2YWFA 5AK0A 4ZV4A 1E2HA 2GILA 2XTMA 2RH5A 3P27A 4JL6A 4M4SA 4KYIB 2IWRA 1JPJA 2FG5A 5GVSA 4A8JC 1F3OA 1E98A 1L4UA 1XTSA 2IXGA 3QXXA 4TSFA 1CR0A 5E7IA 3UMRA 2WTUA 2QG6A 1KJYA 4Q4LA 4AKGA 4PR0A 4OK5A 1G5RA 4QBIA 1JJ7A 2BOVA 1UADA 1XPOA 2ORWA 1Z0KA 4XVQA 2ZIAA 3LY5A 4NMMA 4UNSA 1KI9A 2FA9A 3U3MA 1N6IA 2H5EA 4GSYA 1YZQA 1WE2A 1E0AA 5EP2A 1P3JA 3AF3A 4UXIA 2QBYB 1XTJA 2BWJA 2YKGA 4I81A 2FSIA 4TTRA 1LB1B 1BH2A 1OYWA 1MT0A 4E5UA 1C4OA 4ESHA 2PEZA 4MITA 1HH4A 3CH5A 3WYGA 1RZ3A 1ZM3A 5G3ZA 4Z1MD 4CYMA 1XTIA 4QNRA 4PX9A 4Q4AA 3W5IA 4CGZA 1TADA 5HPYB 4OI1A 2WWYA 1G8HA 6Q21A 1OFUX 4KFRA 3VNVA 1OYYA 2FGJA 3KTAB 2AN9A 3CR8A 4HLCA 4BRWA 1ZC4A 2HV8A 4LJ7A 4P4TA 3KKPA 4GBMA 1GNPA 2XTNA 1N6KA 4G3XA 2VBCA 4PHHA 3VU9B 4Q1AA 3X1YA 1OXTA 1OE0A 1A82A 4A2QA 2GDJA 1T3HA 3KQKA 4UNNA 2V3CC 4KI0A 2E87A 3OIWA 2PZEA 3VAAA 5EXSA 2JLYA 1ZAKA 1R0WA 3BD9A 1KMQA 3QNUA 1VCMA 3KDSE 3QE0A 1YZNA 4JJZA 2ZRCA 2ZJYA 3GLGB 3QXJA 1RYHA 3FHTA 1E79D 2FDCA 3BFVA 4Q4JA 3RRMA 4F91B 4RZXA 3EPKA 4Q1FA 2F3RA 4HB4A 3ZVRA 4ZIRA 4PAOA 5TY0A 5FTLA 3NH9A 1CS4C 5JLJA 4GZMA 3BWDD 4KFSA 4ZO4A 2ZRJA 2CMKA 4LCBA 1EK0A 4U5XA 4RFVA 3BE4A 4DDVA 3CKLA 4OI2A 1E4YA 3QPWA 3N5CA 3BGWA 4WBSA 4JLBA 4GFDA 4MYUA 1LFDB 4FCWA 3TUIC 1BYIA 4MKGA 5BW8A 2YYZA 4GZLA 2FSFA 4XH9B 4A2PA 4HLUA 4PC1A 3C41J 2QRNA 2VHJA 2C9OA 2A9KA 1PUIA 4CRWB 1IN4A 3BC1A 2WMNB 2W6ID 5DNYB 1GKIA 1M74A 3BJIC 4IOMA 1XZPA 4JLKA 1D2NA 4F4JA 1N6RA 3Q7QA 1GILA 2OESA 4IDOA 3SS8A 4FMDB 3AM1A 5CK5A 1ANKA 3NXSA 2EQBA 4EJSB 3CZQA 3TR5A 4LV5B 4Z1MA 1G3UA 2F43B 4MUAA 4V0OA 2GBLC 3N2EA 1EFCA 3U44A 4ZPXA 5FUXA 2GXSA 4NKRA 4G5GA 1N5IA 3LXRA 2XXAA 1N6LA 4O3MA 4ASUD 3GEEA 1B23P 1Z47A 4B44A 2UVQA 5DYGA 3AP1A 2Q6TA 4QBHA 1WA5A 3RAPR 2OUKA 2ZR0A 3QF7A 1NIJA 2CK3A 2FMXA 4JZKA 5E7JA 2EFCB 3D31A 5JEEA 5F9FA 4M8NE 2GESA 1F2TA 5FUYA 1EG7A 1DVRA 3VR5A 5JSZB 4PSAA 2QT0A 4M0LA 1SVMA 3BORA 2ZVPX 3CB4A 5KOYA 2YV5A 1DAIA 1P62B 1G19A 1QHGA 5DYIA 4F93B 3WXMA 4HZUA 4FWTA 1TX4B 1X86B 3ZIAA 1QHHB 1DBSA 1P2VA 1W4CA 2PLFA 5FPYA 3W6PA 2YNMA 1NKTA 2BM0A 1W4BA 1HQYE 2GNOA 4MRNA 4Q9IA 5LB2A 3LD9A 4DLZA 1A5TA 3KL4A 1W0JD 1E2GA 1VTKA 1PLJA 2GF9A 4DLUA 4TYYA 4PC6A 3VQTA 4BLQA 1CJMA 4F4CA 1E2QA 1QVRA 3MRSA 4QHTA 4V0KA 2RGNC 5J4YA 2PZFA 3T06B 5FH9A 2OILA 2IUUA 3GP8A 1GIAA 4B33A 1KMHB 2ANCA 3BOSA 3RABA 4EPVA 5AJZA 3D6TB 4KCGA 3LXXA 4US1R 4A82A 1QBKC 1IY1A 1U98A 2J87A 4XWAA 4HUQA 4BE7B 3KJIA 4AKHA 1ODFA 4JBWA 3A58B 4DLRA 1U0JA 3A1TA 3EASA 5FL7A 1G17A 1DE0A 4Q1CA 4TLAA 4LYAA 5IF9A 1TPZA 3GQBA 3KJEA 4TL8A 4WZ6A 2NO6A 2V6JA 2OBNA 1XMVA 2W83A 1YR7A 2EYQA 2ORIA 4XSHA 4ABYA 3U61B 3SQWA 2QE7A 3WBKA 3LLMA 5EE0A 4PO8A 2QI9C 4TMXA 3AF0A 4QKQA 1NJFA 5DI9A 3W34A 4BLOA 4A4DA 4HDQB 1Q22A 2QMUA 3EC2A 3EPLA 3B85A 2FFAA 2ZUCA 3ZQ6A 1ZD8A 2KE5A 4EPRA 2FEOA 1N25A 2ZYWX 1S4QA 4O2RA 1NRJB 4IDPA 4DT1B 1Q1QA 3WMGA 3EAQA 2OXRA 1J70A 3A1WA 4L4UA 1KO1A 3I5XA 3TSZA 4NZYA 4YQFA 2X2EA 3U3RA 2YOGA 5K8IA 3QKSA 4RFSA 1NBME 2ZRGA 3CONA 3C5CA 2YVUA 2QRZA 1UFQA 1YQTA 1OH6A 5EXTA 1AA9A 3Q3JB 2Q3HA 2QBYA 2GXUA 1Z0DA 4M53A 4OHWA 5EP4A 1NN5A 3E70C 1E99A 2XOKA 1N0WA 3MG9A 4BZXA 1XEXA 3F3YA 4B2LA 2ATXA 2ZI9A 4ILEA 4TWZA 4JVMA 2CDNA 4PO9A 1U99A 3NBZC 4IJMA 1P2UA 1JQLB 1AN0A 1E9RA 1KK3A 3ZS9A 4ARZA 4DZZA 2EFGA 1IXZA 1TU3A 1RRFA 1W5TA 2JLRA 4JIMA 4M1YA 1ELOA 2ZE7A 3EW9A 3CR7A 1JI0A 1L8QA 2VHCA 4TQAA 3KB1A 1JECA 3THYA 1HV8A 1OIXA 1N0UA 4JLDA 1VKJA 2C8VA 2H8KA 4IDNA 3PUVA 4HI0E 3PEWA 4V0ME 4TYWA 4FMBB 4V0LA 3V4FA 4V02A 1T5LA 3KJGA 2WV9A 4OK6A 4Q9JA 4EQ6B 2GJ9A 2YOFA 3M1IA 2AFHE 1DEKA 2CK3D 2IEYA 2WWWA 2HYDA 2ZRLA 5EE1A 1Q12A 1Q3HA 4X8OA 2HF8A 3RLFA 4C0BA 5DE3A 3NWJA 1RYFA 2KJQA 4QFMA 5F2EA 5K8LA 3KXKA 1E2DA 2GCOA 3L0OA 1E4VA 4OI0A 2B7BA 3OHMA 4DCVA 4L8GA 3B1XA 3JZMA 3MWJA 1W7AA 2O8EA 4M1SA 3IO3A 4RJLA 5CB8A 4HLDA 1XMJA 4AWXA 1ZW6A 1N0VC 2FZ4A 3RVBA 2A5JA 3DL0A 4URVR 3C5HA 4RZ3A 4E22A 4QGFA 2O0KA 1GNQA 2CLSA 3BERA 1XTKA 2FNAA 3HU2A 2YINC 4NYJR 1W1WA 1TQDA 3U3KA 1N3BA 2ZU6A 2JJ2A 1DADA 1UKEA 4XJXA 3THXB 5B64A 5BXQC 5DHFA 2WIBA 1PUJA 5E7MA 3U3JA 1W4RA 5G40A 3QF4B 5BN4A 4KFUA 2I1QA 2Q3MA 4TMWA 5KSPA 3U3OA 4JLVA 3U7EB 1ZJ6A 3FDIA 4H1UA 4DB4A 1S3GA 2HEIA 4PSVA 4DSOA 3CX8A 2KI5A 3UWOA 2Z83A 3ZGXA 4BPBA 2IC5A 1NP6A 2R2AA 4IXNA 2BEJA 4B76A 2ORVA 3DVLA 3DO6A 1R0YA 1VDZA 3H86A 4HAVA 1EESA 1RRPA 1OXUA 1GUAA 4PHFA 3ZDQA 2V7QA 1E0SA 1KO5A 2C98A 2QEQA 3WYAA 2PEYA 1UEJA 1U2RA 4D81A 2QY9A 2AKAB 1KO4A 4ACAA 1SVLA 1YE8A 1TF2A 1ZD9A 2CHQA 1QDEA 1OT3A 3FE2A 4ZKDA 4DLVA 2PX3A 3ZYCA 1N6PA 4PHGA 3SZRA 5KSZA 1XJCA 5UKDA 4BFYA 3OEHD 2DCUA 3VHLB 2V1XA 2IUSA 4R2HA 4CT4B 1M2OB 2NOAA 4I99A 3GJ3A 3TAHA 2XGJA 2W6JD 1XEWY 2QPOA 2XX3A 1VHLA 4AI6A 1R2QA 2O0JA 4DLTA 2Q9BA 3K0CC 1G3QA 1XJQA 2IYWA 1TQ6A 1BIFA 1ESMA 3LA6A 4LHVA 2O8BA 1NN1A 2B8WA 2H7VA 3CPJB 1EWQA 4QOSA 3FKSD 4FI3C 3TE6A 3PG5A 2ZI3A 4D0GA 2ZUBA 2BC9A 4G01B 2QENA 4CEJA 3QKRA 4HEJA 4JYBA 4P33A 5F3WB 1E1QD 5FBVB 2JJ2D 1CIPA 2QAGC 3BS4A 3IPYA 4LHXA 3C15C 4RD1A 3D7MA 3ONWA 1G8GA 5JHGB 2ZI5A 2NO1A 2FFQA 1G4UR 2AKYA 2G83A 4YDSA 2AD5A 3GCGA 3IDQA 5FUWA 4MYCA 2P5SA 3G0HA 2J5XA 1S0UA 2GZAA 1EFTA 1XFAA 1HT1E 1UJ2A 2OEPA 1XMIA 4WZAE 1P9WA 4B43A 2D7DA 4D6PA 1R6BX 5ELXA 3K09C 4XVUA 3RS2A 3QIAA 3H2YA 3RS5A 4HB2A 2OO7A 3TW8B 2DR3A 3UMSA 3ADBA 4I1UA 4TSFD 2DPXA 5EE9A 2QSYA 1LF5A 1D5CA 3AP2A 1E9SA 3AVPA 4IFEA 3ZD6A 2XSZA 2ZETA 4URUR 4DIEA 4IRUB 1GAJA 2JCSA 3MJHA 2RKOA 4PAMA 5KSYA 4UNQA 2SHKA 5L3RA 4A6PA 1RC8A 3G82C 3D8BA 4OJQA 4BQSA 2BBOA 1YZGA 1FPMA 1XXHB 721PA 1N6OA 2CNWD 2OFXA 1FP6A 4YMWA 4B3BA 5FTKA 1CRQA 3X2SA 1HEIA 1E94E 3REGA 4TQUS 2LWIA 3EIQA 1XCPA 1YR8A 3DZ8A 2QAGB 3A1VA 1KGDA 1KNXA 2ZAOA 3MD0A 2IYVA 1CRPA 3FB4A 2ZE6A 3I5YA 2GJKA 2WKPA 2D74A 4E09A 4A0FA 2NGRA 1G7SA 4F92B 1RIFA 3NBXX 2ODWA 4MRSA 1FNMA 1ZUNB 4KHZA 2O52A 3GLHB 4LRWA 3K9NA 1NBMA 2X8AA 4GDFA 1G291 1OFIA 1UKYA 2OCBA 3GFPA 2J0SA 3ASZA 2WJIA 5LPNA 1XX6A 1US8A 2WAYA 2IX3A 3FMFA 221PA 1YRAA 4DKXA 3T5GA 3CRQA 2FF7A 4B3XA 4JT2A 1KO7A 4CZ2A 1XXHE 1KJZA 3A4LA 3IGFA 1R5NA 4LBVA 2R62A 2RGBA 2BDTA 4GOJA 3P1JA 5EP3A 1W36D 2DYKA 4HAXA 2GRJA 1YU9A 2BMFA 3K70C 5DGXA 1ZBDA 2JA1A 421PA 2RGEA 1GRNA 2NTYC 4S2EA 4C3ZA 4CT5A 1E9AA 3TW4A 4DDWA 4G5OA 4D0LB 4AG6A 5KDLA 3K09A 4HDOB 3TVTA 2N46A 4Q03A 1TQ4A 3TR0A 1YR9A 3K1JA 2H18A 2QU8A 1PV4A 4EJSC 2EFHB 5D3QA 2J0UB 3H4MA 3KKQA 2XSZD 3UKDA 4QRHA 4PC7A 3NIBA 4K8OA 4LGMA 2CLDX 1KI7A 2YWHA 4RKEA 2NO0A 4C30A 2OBMA 5K8TA 3CF6R 4OHZA 3LVRE 5CIWA 4LC0A 4Q48A 4WA7A 3AGQA 5JECA 1K5GA 4HDCA 2F7SA 3QG5A 2J3EA 2ANBA 4MQBA 1W48A 5C2JB 1E32A 3C8UA 2VEDA 4A9AA 4A2WA 4BUJA 4JKYA 3ADCA 1XU4A 3A36A 4EUNA 1RJ9B 1ZINA 4TLEA 5BYJA 5J47A 3QKSB 5HCNA 2OCPA 1II0A 1Q20A 2EFEB 3V00A 2ZAMA 4US0R 5JI3E 3A4NA 1T0JB 1YJ5A 2G77B 3UK6A 2IF0A 5FOSA 2QM8A 1D9ZA 2GZDA 4GMDA 1AKYA 2GJAA 3VNUA 1GOTA 4PZLA 1X3SA 2HUPA 4LBZA 2IUTA 4TT3D 4LBWA 4RD3A 4C7OB 3QKRB 3U6KA 2C9CA 2D4HA 5FPSA 2QP3A 2QGNA 2ZRPA 5ANRB 4DCSA 1CLUA 3B1VA 4OQNA 1FQJA 4P3YA 4DCTA 5JEDA 3CNNA
chains in the Genus database with same CATH superfamily
1E6WA 4WEOA 4M9CA 4ARUA 3AUSA 1YIAA 3Q2IA 4QFCA 3L8ZA 4B6EA 1T6ZA 1L8OA 5JMWA 1G64A 4HD8A 2DFPA 1JAIA 2Q8PA 2X3UA 2XXJA 3OMLA 1AX9A 1ZWKA 2ZPUA 4HK4A 1Z6ZA 4J2OA 4DEYA 3HB9A 1FUEA 1CR6A 3EARA 1GZVA 1XBTA 1P1HA 1JLRA 1YZYA 3CG0A 2ZQZA 3HZOA 1E1KA 1TDJA 1SCQA 4JX9A 1B00A 1NURA 2DTXA 1WPQA 2IYOA 4DTCA 1N2CE 2DP4E 4YRZA 5HQTA 5CRIA 1MAUA 2PFGA 3EUEA 1Z22A 3S3TA 1P7YA 3ULKA 4UASA 3DSRA 3T12A 2PT5A 4NBSA 3DS8A 4BGUA 2BUAA 3FCXA 3TXAA 5B30A 1BW9B 1M2GA 1XPJA 1IZ0A 4CEIA 1NXWA 3S5JA 1AHNA 4AZWA 1QC5A 4XWGA 1JIXA 3IQZA 1DO2A 2HIAA 1AK1A 3K0AA 1GWNA 1B4DA 1U3DA 4FDTA 4R3UC 8ABPA 2IXBA 4NOJA 1QIJA 2GA9A 1YT5A 1KWKA 4YP1A 1YJ8A 1EIZA 3EIEA 5HS6A 3IEPA 3MLBA 3QE2A 2DULA 1XZMA 2XD9A 3ORHA 4IO0A 1X94A 3KXIA 4E14A 4GYJA 5IPFA 1K27A 2XAUA 1XTRA 2R47A 1MG5A 5SYMA 2Z1DA 1GL7A 1ATZA 1AF7A 1IN7A 2QX6A 1GZUA 3LQYA 4U6SA 4W7IA 1KFBB 2TS1A 3RVRA 4QDZA 3ZDEA 1AKWA 4CM3A 3L4KA 3HDTA 2OO5A 1RWWA 4WAUA 2UUCB 3IPRA 3ROXA 2C97A 1TVCA 1Y3FE 5JCZA 1RLIA 3PT9A 1FBNA 4MW9A 3FHLA 4RJJA 1F60A 2AMFA 5ALOA 4AJPA 3SDZA 1E62A 3CVYA 3NORA 3DZKA 3TZEA 1RCTE 3VYUB 4L6CA 4Z8XA 5FI0B 1YZTA 3NJRA 2NO7A 4PEVA 4YCCA 2GPBA 3VKFA 2ZXUA 3GLFB 3RFUA 1CG6A 2ZSJA 4D9IA 4QUDA 2HOQA 3RJZA 2AOUA 4WEQA 1G18A 4Z9AA 3RPEA 4EG3A 3TLEA 5GQSA 1MH1A 1MR3F 3UOWA 3VKWA 1Q7RA 1KQNA 3UO8B 1LNZA 2XGGA 3KQUA 2CHGA 2Q8QA 5LSAA 2I2BA 4GMGA 2NSHA 2QL6A 3PQ6A 2I66A 2XE4A 4JODA 4WZBB 1EFAA 4IO1A 1ZVMA 2BBWA 2C3PA 1PJSA 3VV3A 5K0SA 2WFZA 2CDRA 4ZCSA 4S05A 4QGHA 2P65A 3PQ7A 2WHYA 1SCUB 3O90A 1DL5A 1RCFA 2HL6A 3BH0A 4OSPA 3FYCA 2R68A 4C0XA 3LGSA 4EO7A 3G23A 2WJYA 4MJ7A 3I12A 2B4TO 3LQ1A 3WB2A 2VHXA 4Y0NA 1GR1A 4RETA 2I8AA 3UY4A 4PG4A 4CLEA 3T1NA 1Y1QA 1YGYA 3PA8A 2ZTSA 4PZEA 1SXHA 2AOWA 2R1UA 4AWBA 1YR1A 2X1HA 4PLPA 3MTIA 2CJWA 1EH5A 1NQWA 3PITA 2HK7A 1F38A 1HDYA 3H05A 4OIMA 4YDHB 1OFUA 4TYNA 1E66A 1IULA 2X7JA 4L6IA 1JFFB 5FPKA 1Y7TA 2PS9A 2RD2A 2JAWA 2QN9A 3BTOA 2ZYIA 3NHFA 2Q99A 1Z45A 5ENDA 5FNVA 1MJNA 2G63A 2G06A 3FVWA 1DUIA 2Y1XA 1G4AE 1LJUA 1XHEA 1W2HA 3THYB 1F7UA 1DQSA 1P2GA 4MUBA 2F1JA 5BYAA 2PZGA 3EULA 3LZCA 4YP6A 2F8MA 3AL2A 1X7ZA 1C7IA 3GD5A 1IHDA 3HYNA 1QMPA 4U9UA 3VFDA 1QIEA 5C8DA 5DNCA 3NM4A 2Q4EA 2RGXA 2P9BA 4JYAB 4FK8A 1J06A 1U7UA 4DA8A 1P9RA 2B21A 2VWPA 3SZOA 1F0KA 4C5CA 1M7BA 1NFFA 1NJGA 4J1TC 3SJAA 4MUHA 2UUBB 5EXDA 1H94A 1UKCA 2I03A 3F1LA 1UDBA 4MAAA 4X6LA 2R7AA 3W7BA 3LKDA 3K4QA 1K6MA 3LBAA 4XTRA 3WWDA 3B1YA 5ARDA 4CI0B 3L9WA 1YHNA 3U4GA 1PQWA 3H5OA 4LXHA 4RV4A 5ICEA 4Q5IA 3JVUA 2I5PO 4R9SA 2IOQA 2LBPA 2XGSA 4HS9A 3TM4A 5IKPA 4O0MA 5IT0A 5BOSB 4TL7A 3IIJA 2YX1A 3CUWA 3AESB 2JGEA 3LQKA 3NDJA 3DHVA 3W2HA 1ILEA 2FOXA 1TVKB 3D7SA 2NZ8A 5B2ZA 4BY9E 3DV0B 3LVBA 1PS8A 4DNOA 5AD1A 3NTOA 2JAPA 3K0KA 1ZN7A 1XG5A 5JFGA 2CY0A 3LGXA 5CK4A 4DREA 2H7XA 5KREA 3DP7A 4NV0A 1GT91 4NEGA 4QU9A 1UXJA 1ZI9A 3M5CA 4V3BA 2GZHA 3COSA 2QR2A 4OH1A 2FDXA 4O02B 3GHYA 1EUQA 4X3CA 1HETA 1YC5A 3DPUA 3QXSA 4AS3A 4F4HA 5JRZA 4RTLA 4PRZA 3AM3A 4QNMA 5EMJA 4PFSA 2AEJA 3WRXA 1NF2A 2HMVA 3H0EA 1IUOA 3O84A 1Z5OA 3IPXA 2O20A 4KRFA 1FJXA 1M0SA 3L7AA 3FLEA 4PW0A 3ILSA 1XZAA 2I4OA 3C5EA 4MWOA 2WE7A 5KTOA 4FE4A 1W2GA 2EF0A 3DAOA 1I1OA 3ON5A 2CXUA 3H84A 1L5GB 4IGAA 4ZANA 4WVFA 1D1SA 5BNWA 3RWMB 3ETDA 3RWBA 5KWJA 4L07A 1SUEA 1ZGJA 5A3VA 3S7TA 2HNBA 2AG0A 3EMBA 3DZHA 3OQIA 4TMFA 2W93A 3RS8A 4HUQB 4M22A 4YLGA 1E6UA 4PVCA 4AKSA 4BJ1A 2VQSA 5D8DA 2OORA 2XDYA 1XTVA 2YWCA 3UT5B 3KRTA 4OQEA 5DBEX 3HA2A 3WB9A 1ZUD1 3KELA 4BO7A 2C96A 1E3LA 4QGGA 1X13A 1NBWB 2WJ3A 2BGTA 5DULA 3RM3A 2VTVA 3WGNA 2XGMA 9ABPA 3H1TA 1TTTA 2PKWA 5CDSA 4D26A 2FEAA 1WMAA 5CYOA 4YWHA 4GOMD 2VHTA 2YMPA 4B3JA 2V5VA 1FDTA 3N74A 2XT0A 2ZTUA 3BIWA 1TCCA 3DHWC 1ECGA 4GIBA 4UBJA 4JP2A 4Q02A 2LP4Y 4G1UC 3KCNA 1JXOA 3ZDXB 3L43A 3RV4A 1XJWA 3DVSX 3KVVA 1L4FA 2WABA 1ZI8A 4ON9A 1UUFA 1RKXA 1T4CB 1U8YA 1Y81A 4F6LA 3ENQA 4L22A 1O4VA 5LQAA 3GJSA 1XJ5A 1PJCA 2WEKA 5ISMA 2LDBA 3L7BA 1GPJA 1WSWA 3NUQA 1U7WA 2Q1SA 3VZRA 4DLSA 5HR5A 2F1KA 3PUHA 2VA9A 4LYYA 5I7FA 2Q5FA 3NRJA 3SJBA 5FOXA 2Q9UA 2X9QA 2PO5A 5KX5A 1Q1ZA 1Y33E 3PRKE 4IIXA 3BF8A 3T3EA 3O03A 1GG8A 2JCGA 1OT5A 3BG5A 2HMUA 2WMOB 5JDIA 2XMSA 1FX0B 4IH1A 1XKTA 1BCRB 4POAA 2AFHB 5L6MB 2XGOA 1UKBA 4M9QA 1US8B 4UJ3A 5LQSA 3H83A 1WTCA 3KFXA 3QYFA 4JP1A 4OAOA 5JAOA 1DAFA 4I4NA 5DGDA 3ZNOA 3WGVA 1YA6A 4ALNA 1XOIA 4E2XA 1WXQA 3BXFA 3OE7A 3DXZA 3P32A 4RA6B 1MQAA 1IEVA 3ASVA 2YXBA 5SY4A 3LBNA 1W0KD 4NRDA 4RVNA 3T1VA 3S1AB 5CT4A 2ECKA 2FPOA 4G1EB 3LA8A 5JALA 2XRFA 3H1AA 1U5AA 5DX0A 3OPVA 2JVJA 1DTWA 2NV6A 4MI1A 5FBQB 2KMLA 2GEVA 4QVKA 4CQMA 4BQRA 3PL5A 4WQMA 2QE7D 4I8IA 1HGXA 3GRPA 3T95A 4RTOA 4NL4H 1RRCA 1JKMA 4EMTA 4YCLA 1AUXA 1OV6A 3F7OA 2ZSIA 2PZAA 3W3AH 2WVJA 3URKA 1TECE 1X9IA 3SIRA 3NHRA 5JCJA 4ZICA 1U7OA 2DE0X 2YQZA 4RJIA 4H7JA 4TLLB 2AW3A 1CE8B 1O6GA 3UXMA 8GPBA 1GZDA 3H11B 2D6FA 4DE5A 4ZZ0A 2AWOA 1NRXA 1O57A 4JUDX 1JYEA 1KYYA 2QW0X 2YN0A 3TINA 1K0UA 2V7PA 3N6RA 1OXVA 4ML3A 1GADO 3DTYA 3NBAA 2PVSA 1DDIA 3G89A 1FU8A 3MF4A 4FE7A 2HGSA 3C8MA 1AGPA 3KEMA 1IE3A 2I2FA 2PUHA 4Q4JB 1HY3A 1VPDA 1QR2A 2M9MA 5J4KA 5H8WA 3OPXA 1JVSA 4P7BA 1C14A 1TAGA 4JLWA 4R84A 1FMJA 3W05A 4ONEA 3ZKAA 3D3KA 4JJKA 2JIZD 4FDUA 3ZXYA 4NCHA 1KYTA 1TA0A 1V3QE 3MOIA 5IVIA 5LD2B 1S2NA 1KKLA 2IHUA 4NOMA 2WDPA 5L45A 1QRSA 2ZB8A 3IX7A 1U3TA 3BXEA 3IQDB 2E7ZA 1THGA 3CNEA 1IQUA 1DRVA 4L9SA 5C1OA 3H8VA 5EJAA 4E2YA 5LUAA 2XNKA 3HCWA 1N5RA 2ZEJA 1MTOA 1JRLA 1GD1O 1KHTA 2KB0A 2C07A 2CDCA 3IVXA 4KQKA 1NBMD 4BFXA 3RU2A 1JQJC 2QMEA 3AQIA 2VUSA 2P78A 2IBTA 1J1ZA 4L50A 4WGFA 2QP9X 3LQRA 4HCJA 4LZJA 3UT6A 3QX3A 3Q9SA 1U1CA 2JKVA 4C4OA 3V1TC 3WWCA 1J8YF 1H8EA 1HDXA 2EKZA 2F00A 1E1RA 3KTAA 1G8AA 1I4EB 2YWJA 3F49S 2BISA 4OJYA 1XC7A 1FYVA 2J4FA 2ZWMA 1M6HA 1LK5A 3ABIA 3EUFA 4XYEA 2HHHB 1SKUA 4M46A 1XRQA 4EKGA 1UANA 2WWXA 1GPUA 4OFBA 1R6XA 1HEYA 4P31A 4Y0AA 1E5QA 4O8CA 3R44A 3L8GA 4EVQA 2OAP1 2W6PA 4EHLA 4CLRA 2QZPA 3B7WA 3L7KA 3G1WA 3U80A 3GRFA 2R8BA 4KACA 4N3CA 2IH2A 3OX4A 5T4BA 3VMFA 1EFLA 5KQRA 5HG0A 4C7OA 4HQKA 3B13B 2ARKA 1KYIA 1WY7A 1F6BA 1M6NA 2AJCA 2HJRA 2PBRA 2XKBA 2VZLA 3FPLA 5DX8A 4DQVA 1YB1A 5FWYB 5KSOA 2KWIA 1XF9A 2GR9A 4QFDA 2FOIA 1JR2A 1CP3A 1ULBA 2VRWA 4D8WA 4EW1A 4DUZB 5H80A 2VTDA 3SXJA 3HP1A 3H5VA 3FCEA 1GQOA 5SYAA 3BSWA 5TIIA 2EIHA 1SXQA 2UYQA 4ESVA 2NO9A 3HWSA 3H3JA 2J6CA 4KXQA 4PZCA 3HO6A 1SD1A 3SC4A 2OORC 4FT4A 4B3FX 3DDOA 5BSGA 2RMKA 4INPA 3VSAA 1MB9A 1TQHA 2FI1A 2BKEA 1SXJC 3W3AA 1ZYUA 3L1KA 2PGOA 4MPTA 4D9KA 3AVVA 2C2HA 3GROA 4ZPJA 4RZSA 1FLVA 1EZ4A 3CRMA 1HM5A 1R1DA 5HRCA 3RFTA 4C05A 1MV5A 4RHYA 1VKOA 3GOHA 1OKKA 4B7ZA 1HE4A 4EFDA 4Y2QA 1HNZB 4ZT5A 3ZE2B 3NEYA 2C5SA 3IV9A 1NR1A 1PQUA 3DC7A 4FW9A 3QLVC 4LK2A 3AL3A 3AX6A 3LECA 3PDUA 4Y0VA 3LBHA 4A03A 4XD7D 3NR2A 3AHIA 4HBZA 3VI3B 1SUPA 7GPBA 2XWQA 4QQFA 4H77A 1A77A 3B36A 3IIMA 3TGWA 4C4RA 5B3LA 4KQHA 2YJNA 3GPBA 4AMVA 4BVFA 1XFDA 4DPMA 5BQPA 4LI0A 4QKQA 1FZQA 3F7NA 5E4JA 1S8FA 3HGMA 4J94A 2GTIA 5IXJA 5EJ7A 2C9MA 3PXGA 3O91A 3GLIA 2X3FA 1NW6A 1QB7A 3FR8A 1Z2AA 4OQMA 4CUZA 3IHKA 2VPQA 3WWPA 3F5FA 5FOQA 1D0VA 4ZCLA 4Q1EA 4DEVA 2ZS9A 2L82A 4J1QA 3DZIA 1KC1A 1PI3A 3F4LA 2Z3VA 1J5XA 1I3CA 3JQPA 4R2XA 4YCDA 5FTJA 5GV7A 5CCXA 2BKUA 4RIIA 1Z6AA 4MRVA 2GD6A 4L51A 1SBZA 4WZZA 3WA6A 3BL5A 4XX0A 4JQOA 1VCHA 3E22A 3OQIB 4WPGA 3HR4A 4I6GA 4XSGA 3TQFA 1U5BB 4XVRA 3O3NB 3R8XA 3FGPA 3GAAA 1FX0A 4X97A 4FDLA 4JOBA 5ILOA 1FX1A 3LTEA 4A15A 2GWRA 1ISPA 2OGZA 4B1FA 3BRWD 1T6XA 1C50A 1R5BA 3BCRA 3CX4A 1QH1B 3I1FA 3QVUA 1JPUA 3F6RA 1VE9A 2O2DA 4RK4A 2P11A 5G3YA 2ZR7A 2R1ZA 4X20A 4ZAVA 1EHCA 5CLQA 2XWPA 2AXNA 4NCJA 2YVAA 2L17A 4G24A 5IHPA 3H4TA 2PVPA 3B82A 2QAGA 3KVNA 4KIFA 5BV1A 2BR3A 3S2SA 2WD7A 3H17A 1FYWA 3OCUA 1EUDB 4TV8F 4CMEA 5A9SB 1SXPA 1JIQA 4MDFA 3UXEA 5G02A 4JU8A 3U3XA 4IV8A 3HU1A 3D6HA 4CU2A 1G9XA 1M2NA 3FDZB 5JJIA 1DIAA 5CTAA 1KRXA 621PA 4KKXB 2P6RA 1RE0A 4HQ0A 5K09A 3L0PA 1XA4A 1XEXB 3KQSA 3R3HA 4QYIA 3FPBA 3HBNA 2UYYA 3ET5A 1GUBA 1P33A 4MW5A 4BC1A 4DR2B 1Z82A 2V65A 3V7UA 5DM4A 1LC3A 2D2VA 1GFZA 1ND5A 4DGSA 2ID9A 1KXJA 2J7KA 1KJ8A 1C80A 3JW8A 1E5LA 2OQRA 1XPUA 1MGOA 3VJLA 1YDEA 3UC9A 2P6PA 3T99A 3THWB 1V48A 1TM7E 4WKOA 1R4ZA 2MYNA 3IEUA 4ZP1A 3HUUA 3P96A 3K32A 4RK5A 5JISA 2PL1A 3UGQA 4PGHA 1RQGA 1P2BA 4JT4A 5AVKA 2GEDA 5EMHA 3L49A 3TJZA 3TLXA 3JYHA 1XNJA 2V6BA 2JZNA 3AFOA 1UJCA 1BXRA 1FL9A 2IL1A 3OJOA 4YO8A 2VUTA 4XA8A 4B2YA 1WBBA 2RAFA 4EABA 3CWQA 4NFLA 3IAHA 4C1NA 2JA2A 2X8LA 2C3MA 2K2QB 4WKBA 3V1UA 3BRSA 4JX8A 1S7GA 3CUTA 4JNCA 4CDMA 3AUUA 1LVHA 4HWOA 1OLXB 2I1WA 2Y1OA 4L4XA 3HCNA 1HYBA 3IO5A 4KAXA 1J0XO 4E21A 4MO2A 4TUYA 1HL3A 3C24A 1P5FA 1SR8A 3FDXA 2ZFUA 2ZYVX 3I76A 3QWAA 4P93A 5BWMA 4DR3B 4LSMA 1VSBA 2PV7A 2V98A 3EY9A 3GDFA 4M9UA 2H0RA 2GBLA 3MOSA 3U7QB 5JI2E 3CRW1 3LI2A 4BYGA 2X58A 1EDZA 5JQWA 1ZU5A 1O6ZA 1WJGA 2CZQA 2VTKA 3HB7A 1Q57A 4MW6A 3ZV4A 2QAJA 4BZQA 3A9WA 1Z35A 4X3OA 4G97A 2NQ2C 4FMPA 3EGEA 2OHFA 2GI4A 1RFLA 2XCRB 2O8NA 4FB5A 2RI1A 4F7WA 1I7NA 2ZREA 4DF3A 3CH4B 4ZDIA 2BFEA 1MA3A 4W9NC 4W6QA 5D51S 1VL1A 3GRKA 1DAOA 4B7CA 3UV6A 5GADl 3W8DA 4DR5B 3TGPA 4EO4A 1AGRA 1OWNA 3I9KA 4WN3A 4WXHA 2H4FA 1YVDA 3PCTA 4OUKX 1MJ5A 1UINA 4LHWA 4JJ7A 2H4WA 2VXOA 1Q0QA 5EE5B 3PD7A 2PQ6A 1W73A 2VZ8A 2UZ1B 4IVRA 4MKIA 3V48A 3GRCA 4GT1A 4D8XA 1G20E 1FSGA 2Y9PB 4JVSB 3ASYA 1N0IA 4NNOA 2FR8C 2Z6VA 3N3BC 4FLEA 2AOUB 4R5HA 4CN9A 4Z86A 3RASA 5ESDA 4BCBA 2QMHA 3GZNB 2BKAA 1T6YA 3I2YX 2X7XA 1HFEL 1HA3A 4DR4B 3KV1A 1GV0A 1PJZA 3EGCA 5D6OA 4EITA 2Y1GA 1CJVC 5A7GA 3KQNA 3IDZA 4I2NA 3KYDB 1GPYA 3JAKA 1JPNA 3QBEA 1N57A 1EGAA 3GJQA 4QO8A 1XXHA 4WKCA 3GMDA 1QTRA 3S0JA 4X8MA 4N0EA 4MMXB 1RM4A 2E48A 3GG9A 1UBEA 2ORED 3ZE8A 1JN0A 4DQUA 1BXGB 4KV7A 2EC5A 1WUYA 4OQQA 3DEZA 1PP4A 2RAVA 5BMVA 1VJTA 3WTCA 2Y8EA 2W0MA 4IFBA 3O8NA 2WJ4A 4D8UA 4ZOCA 2GFHA 4BASA 4A8HA 4WCFC 4H1VA 4DNXA 3MN1A 3UHJA 4GKKB 5FWNA 3TSOA 3QUQA 1T0BA 3E9MA 3FAZA 5L40A 2GFIA 1IPFA 2UDPA 4DQXA 2XVXA 3G59A 3MRTA 5B3JC 1IUKA 1SG0A 2BL4A 2G4LA 3IXLA 5H5JA 5T4EA 3M6UA 4MULA 3ADPA 3JTMA 2Q6IA 3RBXA 4CCAA 4KBGA 4P83A 4EMUA 1OPRA 2BUBA 4OHXA 3QU4A 3WYFA 2VCHA 2F59A 4RSHA 3E0XA 5KJ6A 2FW0A 2VBIA 3IODA 3IC5A 1HG0A 1I4TD 2I87A 1B6TA 2V9CA 1TM5E 1JG4A 4GPAA 4UULA 4XIGS 2H1OA 4A36A 2QRVA 4QWWA 4BWFB 2ZRAA 2PANA 2F64A 3KZVA 4URZR 2PLNA 1BKYA 1DC5A 3P8ZA 4TGLA 2J7PA 1YR6A 2Q8NA 2VJPA 4D98A 4DJFC 3SXPA 4ER7A 4QUBA 2UKDA 1R7RA 1VPLA 2XT6A 4TVBA 1YZLA 1PDWA 2WKQA 2REXB 3IEIA 4KDRA 1Y6GA 2RHTA 1YBVA 4IMPA 4YJHA 3P0JA 2JIQA 2E4VA 3CNHA 3T5MA 2OPBA 4LJ6A 1Z4MA 4HGOA 1JNYA 3VPGA 2I99A 5CJ2A 4C88A 3IYLW 4G56A 3U7FB 1QGZA 3D0RA 4KVGA 5E1OA 4W99A 2GNAA 1QBGA 3PGVA 4WY8A 3TRHA 5EJ8A 5LQUA 1KU0A 3F47A 3EHEA 4RQUA 4CIDA 3CSSA 4Z7OB 2D2FA 1FS4A 4YB8A 4YUAA 3TRIA 1YZUA 2H6EA 1JP7A 3ZWDA 3RV3A 1UFKA 4XTCS 2GM5A 4UREA 3O73A 4OHMA 1T8UA 4KPEC 1F5NA 3IQWA 3L8HA 2BYTA 1KPHA 4NOLA 2JGRA 1FTWA 4L74A 2NYAA 3DT6A 4XGRA 2CXRA 3Q3HA 3FMIA 3TIXB 4B6RA 1HDCA 3ZU5A 5K6TA 3CKKA 4CG1A 1M1YE 4Z2YA 5EUCA 3EJWA 2ACWA 3DA8A 2ZBGA 2TYSB 2BLNA 1O54A 3FFTA 3HA7A 2DKOA 1P4SA 1E5TA 4ZYWA 2IHNA 2A5GA 3IOBA 4MQMA 5GONF 2FR0A 3X44A 5KYXB 2DPHA 2CLMB 3E18A 5NLLA 4LJ9A 3ZK9A 5FPTA 1G8YA 2ZB2A 4ABTA 2ZPAA 1VXRA 3DZDA 1YL7A 2WYUA 2CLKB 4YONB 5HKAA 3I4LA 3G0OA 4HF7A 4RXUA 4DADA 1RJGA 4YO7A 1IWBB 4RD6A 4KJZA 3QVVA 1JT9A 1ZS9A 4W5OA 3EY4A 3BPSA 3I28A 2R6ZA 1Z8HA 4MVJF 3QFSA 3ZW9A 1N1MA 3H2GA 3I09A 2IX9A 3DEJA 4MLZA 1CF2O 2V03A 3U31A 1YRBA 1ZQ1A 4CT0A 2B99A 2ZJ1A 1FMFA 3LFUA 3ZZTA 2V4MA 3GD7A 4DS3A 3DB1A 3GA7A 5KYNA 4DG8A 1ZNZA 2RKBA 3F97A 3JQFA 2YWXA 2HPAA 2O2YA 1X7YB 4HWPA 1JT2A 2GYWA 2XNCA 1U8ZA 1XCJA 2A78A 1FP7A 3NHBA 4W5WA 4BNNA 1X77A 2ONCA 3B3AA 3F67A 4G2TA 4B6GA 1UDWA 1KK1A 5DSXA 3UK0A 5JC8A 3VC3A 3AVYA 1FFBA 1OQAA 3E81A 5AW7A 1JSRA 1D9XA 4RABA 3HEBA 3JR7A 3WP1B 1D8TA 1GNTA 1FC0A 1SC4A 3K1AA 1Z18A 2Q3FA 4OY3A 3OP4A 2CFIA 2P4SA 4MWDA 1FSSA 4EG1A 3OZAA 5IMBA 1QHNA 4XQ9A 1Q0TA 2FG6C 3SC2B 3L1UA 4YMLA 1L7RA 5KQSA 2NO4A 1RHMA 3N58A 4IOKA 2R8YA 2D8MA 1WB4A 3GLGE 1D2EA 2DFKB 3LX6A 2JAUA 1TM2A 4TV9B 2EU8A 3QLEA 1Y5LA 2C00A 3KUUA 1H5NA 5K03A 5I7OA 3CZRA 4R81A 2VS1A 2VJDA 2IHBA 5T6MA 2CCKA 2AN5A 2Q5QA 4DVGA 1QRTA 3CH7A 5GPBA 3THOA 3TJMA 4LMRA 1J0EA 1CUSA 2RKWA 4FQ7A 2Y1CA 3SBDA 3T94A 5JS7A 2HA5A 1ODJA 4IEFB 4NYJQ 1KI6B 4KIWA 1WM1A 2CFTA 3O21A 5I8WA 4RHTA 2XCIA 1E2IA 2IYFA 3HKEA 2DECA 4PTYA 3SMQA 1NMXA 2BGNA 1INLA 5LP6F 5L51A 1J6UA 1SBNE 1TJ5A 3QXCA 4YBRA 2BMVA 3KUKA 4DG5A 5HGXA 2VK1A 4HQOA 3RF6A 1JWAB 1MJHA 1J97A 2QPTA 2FP4A 1PBTA 3PVSA 4HB0A 5JNVA 1NC1A 3DAPA 1JIVA 1GITA 4ZGGA 4OMFG 2D1QA 3FWHA 4MMYB 2IELA 1I51A 5CDTA 5C9ZA 1P2DA 4RNCA 5DH9A 3C70A 2C5BA 3HA5A 3HBFA 5DISB 1X1CA 1GVHA 1IOZA 4Y6PA 2AFRA 4EARA 5FD8A 2BEWA 1CYDA 2W4IA 3PZBA 3DL4A 4NF2A 1ZU4A 3LJKA 1IN5A 1KFJB 2IZOA 1ZSYA 2CJXA 2WTAA 3DMPA 4G85A 3ME5A 1MO2A 4V0MA 3K9LA 4BRSA 1ID1A 2JIBA 1E1DA 5I5EA 4ALKA 3M49A 2ZCJA 1J2YA 1EP2B 1AKMA 2WZQA 1OUMA 4FGUA 4P08A 5ELLA 1I9GA 2WKRA 5BSHA 4O4IB 5KEIA 3CNBA 3HACA 3AWDA 2QZJA 4O1IA 3SMVA 3AFGA 3SR4A 1J7KA 1DWPA 3PR1A 4QGBA 3EXIA 4CTNA 3MJSA 1GEGA 4XARA 3W6ZA 4Z2AA 1QZTA 1Y6JA 2X2FA 1AZTA 5ECDA 1QFZA 2B4QA 1VJ1A 1XCMA 5BNFA 5DLPA 2MJLA 3Q6NA 1YJAA 2AR0A 3R7WA 4LMAA 3WDSA 4Z3DA 1XAGA 4YACA 1XB2A 1UK8A 5EHZA 1E9EA 4UVGA 2H1IA 5H16A 2ZB3A 3OFNA 1U0RA 2P75A 4PIVA 5TGTA 3I62A 3NRCA 2QTTA 3WQQA 4I66A 5AUNB 1KVUA 4WJLA 2VP9A 1XEFA 3HRHA 5AHKA 1EBBA 3EMVA 2PSDA 1GKYA 4QPDA 1PS0A 4MEJA 1NMEA 1QLWA 5BRNA 4GP6A 1ZI6A 2CLHB 2ZROA 5A3RA 5LIRA 1KI4A 4UCXA 2B94A 3MYRA 3SHFA 1DWUA 1M0WA 1RWQA 3LG2A 3WGKA 4AZVA 1E9DA 1HFKA 3KU4A 4X94A 3V6MA 1YBHA 5TMPA 1JZQA 1WKBA 1C9YA 1M5TA 4S1NA 4REOA 3MGCA 3P0EA 2JH8A 3K05A 1VYUA 4FILA 1PFWA 4GOND 4MHTA 5I6DA 3DKRA 2VP3A 821PA 2H5IA 4QVGA 4MYHA 2B7LA 5L3ZA 3UFXB 3H87A 2ZSDA 2CNBA 2VPPA 1NL3A 1VB3A 4G4IA 1EFDN 1EGQA 2ZI6A 1DEAA 2J59A 1T5OA 1I2BA 5KPJA 1OI2A 2P4HX 3LK6A 5K51A 4A91A 5M7EA 4QIHA 3HNPA 1QHHA 1KI1A 3WICA 3NNSA 3A1CA 4OJMX 4YFVA 1CJUC 3QENA 3GEPA 3BWEA 4XGKA 3PWSA 3WAKA 2BGRA 1MO4A 1H2EA 1MABA 5DHPA 3NDPA 4NULA 1E3EA 5KSZA 4BMNA 3CMMA 4P84A 2C99A 3WK6A 4W6ZA 1W6UA 4WVLA 2ECFA 4DC9A 4I50B 5FFMA 4YP0A 4DV5B 3W2EA 1I2DA 1LDNA 3C6BA 4MUYA 2BTQA 4LF6B 1G41A 4JA0A 2CXPA 2OCIA 5EVJA 4XR4A 1TRKA 4OOEA 1LVGA 4GOXA 4PAGA 3DEKA 1Q7CA 4PE5B 5HIKA 1YTUA 1U11A 4N7RA 4TN1A 4F6CA 4ZI2A 3H2SA 4A8JB 1R0LA 1M8GA 1IC6A 2WHEA 3I2IA 1H5UA 4UNPA 3R74A 2CJWB 5G2OA 3HVIA 3OCVA 3LYUA 4KGVA 1MX3A 2P77A 4K03A 4FEGA 3IILA 3HZRA 2OC9A 4FBGA 3CQ9A 1Y8AA 5IC5A 4B7XA 4M76B 1XVTA 1QKKA 1RI1A 5BV0A 1IJEA 2WTBA 2IIVA 4WY2A 5C7OO 1RLTA 4DRZA 3VKHA 4RS3A 3RYCA 1F20A 4GUAA 2F1HA 2JLZA 4S24A 4NK4A 4D1YA 1QP8A 5KCMA 2XXAB 2BP7B 3DG9A 1CB7A 4ZO9A 3I2HA 4KNWA 5HS4A 1PG5A 1ZJ4A 1YDGA 3GFTA 2PGLA 4I1OA 3ZXXA 2K5UA 2YOHA 1SN7A 3JU3A 4OU4A 1BX3A 4MVJI 2A2ZA 3TKAA 4D9CA 2HFJA 3VTZA 4CM8B 1SXGA 5AW1A 1L7AA 2VAWA 1KI6A 3HZZA 2QZZA 1FJ2A 4TSRA 3OZRA 3T7IA 3QBVA 2Z09A 4MQFB 4QT4A 2ZT7A 2IPOA 5KC8A 4PIMA 1UT6A 2WUWE 10MHA 5AHWA 2AMVA 1X6VA 2H31A 5I7WA 4MAFA 3PGXA 3CGGA 4II7A 1VRVA 1Z36A 2YWGA 5JE8A 1M6VA 3W8NA 2EP7A 1QZ3A 2GVNA 1E2KA 2YJ4A 4YRPA 2GHQA 3AI7A 4UBMA 4EL5A 1VZ2A 2P9GA 1NUPA 4W7SA 4OHKA 3RRFA 2ESRA 5H9VA 4UM8B 3R20A 5EIHA 3AR5A 4OEHA 3DZGA 4N47A 5J1SB 5DNWA 3FMVA 3MA0A 5U4QA 3WGGA 5F7OA 1N75A 1WHTA 2YYYA 2L0XA 4ZCIA 1E3TA 1VMDA 2WAAA 3G2IA 5FFNA 3WBJA 1LPSA 4TM8A 1EFRD 4KN9S 2D8AA 5K3FA 3ZX4A 3BMCA 3DCIA 5I4KA 1ONBA 2DZDA 1TI7A 2XJ9A 1QO0D 2LCFA 4LOAA 4EGAA 1CP2A 1T3GA 1ZICA 4H0CA 3UFBA 2AKEA 1GJRA 4BVEA 1AKUA 4UHCA 2NADA 2PKCA 4HXFB 5EWMA 1O9HA 4IDBA 1P2TA 5GJWC 4D44A 3O93A 4EMSA 3RKRA 4CMJA 4XFKA 4TLDA 4XRGA 5KU1A 3Q7EA 3O9MA 3WKDA 4KHPB 3R6TA 1OHHD 3DDUA 3U44B 1DKPA 2E9SA 3H2BA 5LUBA 3NVMB 3HXOA 3B78A 1S5PA 1DFHA 1YK1A 3TZHA 2AFVA 5BQ5A 4LNHA 1WUIS 4D96A 4QJ3A 5CXQA 1LEHA 2AA3A 3KHKA 3LKVA 3EH1A 4QYMA 4O5OA 4DJDC 3O4JA 3RS7A 4XQGA 1Z39A 5JDCC 3Q15C 5KWIA 2G04A 5KYKA 1A9PA 2JI7A 2XEXA 1AQIA 1UPCA 4JP3A 1GTSA 3O8DA 3RYIA 4DV7B 4DBVO 4JXZA 3PJEA 3RJ9A 4RTRA 1N6NA 4CGYA 3L7CA 1S2DA 2FETA 1VRCA 4RPIA 4Q1BA 4RF5A 4YV2A 5JAZA 1B6GA 1SVKA 2XUIA 1DG3A 1V16B 5G4KB 2ZE8A 3LT0A 4AYWA 4BGVA 1WDKA 2K7ZA 1UM9B 2RK3A 2FSSA 4BMXA 2BIFA 1CY6A 3DMHA 4AY3A 2OWDA 1RRMA 1WDMA 2GLTA 2OXFA 4DR1B 1NOKA 3K53A 4FFRA 2BV3A 3ZU2A 1UMDA 4NCKA 2VP4A 3Q4GA 5JCOA 1Z4IA 1DIBA 1W88B 2I67A 4MGIR 3ZE6A 2YWEA 2W2QA 1SOAA 4J0HA 3ROMA 1ONPA 4EJ6A 4RYLA 2GZ1A 2B3DA 4PLCA 4YRAA 1S9HA 3AF4A 4PZZA 4DV2B 2AOVA 2HMYB 1T1IA 4NARA 5B53A 1L3CA 3BFPA 4ADSG 3RVOA 4U7HA 3QY9A 1Y0BA 2OCXA 4A6EA 3ZD8A 5CDUA 3Q8XB 3AF1A 4P0QB 3L8EA 5LKAA 2Z2ZA 1AKQA 1DAPA 2H11A 5F5NA 1V5FA 3FFBA 2MSEB 5AM5A 2FX2A 4J03A 4CKCB 1E59A 1E2MA 3RU3A 3PPWA 1R9JA 2FZVA 5CPBA 5I7AA 2B5VA 3PHBE 4IHJB 1FK8A 4XUCA 2R0QC 2JEOA 1ORVA 1S8OA 5J5CA 4M0FA 1SBYA 1GU0A 2I8CA 3ZCTA 2PUDA 4C1BA 5DJ5A 3AFHA 2OZVA 4DR6B 3ZI4A 3HU3A 4IIGA 3GBVA 5JZSA 3DTVA 5TF0A 3C3BA 2FE4A 3QEKA 3VH1A 2XB4A 4TZTA 5HKLA 1H1LB 3WGYA 2AQHA 2IYUA 2HHCA 1P29A 4IRXA 4H4EA 4IHAA 5LP1A 1NLUA 3BWBA 3T38A 3WLKX 3ND7A 4P32A 2XMDA 4CCWA 4YRNA 3G8DA 4LYFA 5EIBD 3TQIA 1W5AA 3ZV5A 1QFMA 1TIKA 1X14A 4PTLA 1U2GC 2PY6A 1IZ9A 4JELA 4YVFA 5E6RA 2HHAA 1WUTA 2QUJA 2RJOA 1YAHA 4OHRA 4G84A 5AM0A 5A4FS 5EJ4A 3WLLA 2EZTA 3DOOA 1XTQA 3T34A 4J3NA 2W2PA 3RQIA 1CJSA 4CMKA 3NM5A 2ZTMA 3PQ5A 4GYWA 1QPGA 4BKUA 4JMLA 1V2GA 1JSCA 2XE6A 4Z7JA 4AAYA 3DMRA 2B4YA 3GEGA 3OX2A 4FBLA 4ND2A 5EOVA 4D7AA 1KQFA 2F3SA 2WPDA 1PR1A 3GNQA 2A84A 1T3SA 1W4LA 2JIPA 2PZJA 4FB4A 2JLVA 3NC1C 1UBHS 3Q6MA 2O2HA 3KTFA 4KFTA 2PJUA 1FW8A 3PF9A 1U9JA 3C14C 4BVBA 1EFKA 1SBCA 4LYGA 5CIQA 3PTAA 5BWLA 4I1IA 4D3YA 2YCLA 3AYXB 2GRAA 2WU0A 5E0KB 4AJ2A 2VDWA 1Z38A 4Q6BA 1U0OC 4HAYA 1YJCA 1U3FA 2CSUA 1JMVA 1KI8A 1R18A 2G5TA 4FOTA 4IDHA 4ECEA 1FOEB 1MKYA 4JDPA 5JU6A 3R7NA 4DCPA 3EF0A 2IIBA 3E9EA 3IP7A 1Z4OA 2QNRA 3IVGA 4CIWA 1XCBA 5DVZA 1IQPA 3ROQA 3ZI0A 1C3JA 2FEXA 3GFQA 3PTLA 3QE3A 1NXXA 2C57A 1DPFA 2Q3BA 3V9AA 3EZ7A 4EAQA 2YWBA 2XUZA 3FYHA