6CHYA

Structure of chemotaxis protein chey
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CheY mutants Y106W and T87I/Y106W. CheY activation correlates with movement of residue 106.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Signal transduction protein
molecule keywords CHEY
total genus 46
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6chyA00
1JDPA 3C3KA 3GA5A 3LMKA 3M9XA 4YR7A 7ABPA 2HQBA 2LP4Y 3QELB 1RXEA 3QX8A 3RVKA 1JFSA 2PMCA 1SXIA 3BRSA 3QX9A 4G0OA 3T38A 4MQFB 4YGXB 2M1ZA 1KRXA 4WXMA 3JVIA 4IRXA 1NXPA 4S04A 2YHBA 1F4VA 2NZUG 4RU1A 3KKEA 3UK0A 2IPLA 4NCAA 4KFCA 3OLVA 4RK4A 1YK0A 2E4UA 4MR7A 4XARA 1JYFA 2WJAA 5CNKA 3GWGA 3OLWA 2HPHA 3H5OA 1USKA 2XDYA 1SXHA 2FLWA 4G0YA 4RKRA 1Z2EA 1TJYA 4W5QA 3HO1A 1H9CA 1FSPA 2E4ZA 3GYBA 1YIOA 2A9OA 2I6FA 1TMYA 4GNRA 1A0OA 5FWYA 2FTKE 5DGCA 1A04A 3QELA 1GUBA 5JNSA 3W9SA 3OQMA 1E2BA 2FMFA 3C3MA 4OLBA 2PLNA 1SD5A 3G1WA 4MS3A 5EWLB 2FMIA 5JNUA 2A9RA 3H5IA 9ABPA 5HQJA 3RVRA 2A9QA 1Z17A 3BBLA 3URMA 1EWTA 1P6UA 3CG4A 3CNBA 2WJWA 4G86A 1ZH2A 4NICA 1NXOA 4N0PA 4EYGA 3KYIB 3OQOA 2FQWA 3HZHA 3HDVA 3N75A 3SG0A 3DLHA 1GLGA 3JTEA 3RVMA 1DBPA 1MVOA 4Z4IA 2AYZA 4XXHA 1Z16A 4MR8B 1APBA 2JK1A 3MQ4A 3HUTA 5B3JC 4RY0A 1NXWA 4EGSA 4KREA 1B00A 1W9HA 2MYTA 1PNRA 1NXTA 4MLCA 3Q7RA 3QLVC 1RPJA 3QEKA 1MB3A 2VYCA 5DTEA 4PICA 1DCFA 1DBWA 3JPWA 3LOPA 4MS1B 4MQEA 4O1IA 1NXXA 3KLOA 3CS3A 2IPAB 5TQJA 3RQIA 4MS4A 2WMYA 3LUFA 2IYNA 3IDOA 5B3JA 4GPAA 4EVSA 2PUEA 4RK1A 3NNDA 4YO7A 3JS5A 1YTUA 1P6QA 3QLTA 4JB0A 4E7PA 4B09A 4HYEA 1S8NA 1JWLA 2R25B 4WT7A 4ETMA 2IKSA 3QK7A 4N76A 3N53A 4XLTA 1CYEA 4P98A 1DJMA 4MS4B 1Z18A 1AB5A 4ETIA 1BDIA 3I45A 4RKQA 4D6YA 3M9WA 4LX8A 4S05A 4ETNA 4KV7A 4RK5A 4KPYA 1D1QA 4MQFA 2R48A 1LBIA 4EY3A 1QMPA 3CHYA 4EVQA 2TMYA 2PKXA 4D74A 5C5CA 3EULA 5TPWB 1VKRA 2PUFA 2PL1A 4RV5A 4JOQA 3H6HA 4TMYA 2LIVA 2B4AA 2JCGA 4LDZA 5JNRA 5KQGA 5ED4A 3IP5A 5TPZA 1ZDMA 2FKAA 4WZZA 1CEYA 2QW1A 1M2EA 4MR8A 1QP4A 1U2QA 3EQZA 3FGZA 3LUAA 3Q9SA 4OTZA 4ZJPA 3R0JA 3RVQA 3K4HA 1U2PA 1U0SY 3F6CA 1ZHHA 1L5YA 5CHYA 3HEBA 3OLZA 4TN5A 5DLEA 3C3WA 5IEJA 1P8AA 3RVJA 2H0AA 4H3KB 3TO5A 1Z13A 3HS3A 2IOYA 1ABFA 1BVHA 3LUGA 1VPWA 3UKJA 2L17A 3TD9A 1OXBB 2FXIA 3A10A 4KK4A 5HSGA 4RK0A 3O2JA 3HSYA 1VRVA 1EWVA 2FQYA 3MF4A 1YVUA 2FMKA 4RXUA 5CNJA 4RSMA 1SXGA 1ZITA 3EAFA 5EWJA 1ZN2A 3F7NA 5KQMA 4D6XA 3QLVA 1C0EA 4G0MA 1DCKA 3H5VA 4QICA 4Q7EA 1RZRA 2CHFA 3HVRA 4EYOA 2FVYA 2FN8A 4G97A 3ILHA 2P4UA 4RY8A 2PE5A 1MB0A 2X7XA 1UDRA 4YV7A 1T34A 3MM4A 5JNTA 1YMUA 4TLLB 1EFAA 1M5TA 5IC5A 2V0NA 3FMVA 3EJWA 2PJUA 4TLMB 3F6PA 3LFTA 4MR7B 1FFWA 4N03A 2PUCA 5GQSA 3N6VA 3M6MD 3QLUA 4RK6A 4Z99A 3MYYA 4Z4FA 2VK2A 2IPNA 4H60A 5JS2A 2CHEA 1NTRA 2LUOA 4KQCA 5BRJA 2J48A 5IX8A 1Y1LA 1JF8A 2MSKA 4HNQA 2CWDA 2MYNA 2FW0A 3BRQA 4KQ9A 2N9UA 3IPCA 2RGYA 4KK3A 5HKOA 3L49A 2QVCA 1J56A 2R4QA 4IILA 4F3TA 3E61A 2RJOA 1YS7A 2QU7A 2LBPA 3OMXA 3LUHA 2GI4A 3KJXA 1FFSA 2MSWA 5DCLA 3A0UA 4IMJB 3MMNA 4QYMA 3HXMA 5KI6A 1VLZA 3N0RA 4YS6A 5D2CA 2RJNA 3GBPA 1GCGA 2ID7A 2PAFA 1ZGZA 3FDFA 2FLKA 3CG0A 4YP9A 1DBQA 1KMIY 3DZDA 3GBVA 4RK7A 4XASA 2DRIA 4F06A 4IMIB 4G0PA 2Q5CA 2PUDA 5TQ2A 3RVPA 3LUJA 1R8JA 1PHRA 1QNLA 1BA2A 3SY8A 2NUBA 2B1JA 1D5WA 3FFXA 4L4UA 2JBAA 2GBPA 4H3HB 4QYWA 1U04A 2H3HA 5KC9A 2JVKA 3O74A 2F8TA 3OM1A 3Q41A 5FWXA 3OLYA 1QQAA 1JFVA 3OMWA 5IEBA 4MRMA 1QP0A 3HUUA 4W5OA 1JYEA 1TM2A 1Z26A 3KG2A 1ISSA 3H6GA 1TVMA 1ZH4A 4WUTA 1W25A 4DQDA 1DP4A 4WWHA 2KYRA 4NCBA 4ZMSA 1BDJA 3OQNA 4HNSA 3SNKA 3C6QA 2VUIB 3OLXA 1DZ3A 3K9CA 8ABPA 1RXIA 1PUXA 3NHZA 5JS1A 5HM6A 3A0RB 3QEMB 4CBVA 2A9PA 2E4VA 1SRRA 3GT7A 3KSMA 5CNMA 4F12A 2MYPA 3NHMA 4MR9A 4WXEA 4IGAA 4Z0NA 4FB4A 1D1PA 4M88A 4G0XA 3DBIA 3FFWA 3EGCA 4Z4GA 3T8YA 4JA2A 2E4XA 3IP7A 3HJFA 3OO0A 2ID9A 3F73A 2QXYA 5BRAA 5DKFA 2QVGA 3C97A 1ZESA 4KZKA 5PNTA 3T95A 1KGSA 2HJ9A 5T7BA 4EYQA 1XWWA 3N0WA 3ILYA 3OO1A 1EWKA 3KYJB 5IBQA 3TX6A 3BILA 2OENG 3EDCA 2BGGA 3Q7SA 1DG9A 4RS3A 3O1JC 2F8SA 3VNAA 3O21A 4JAVC 4OATA 4MRMB 2NZVG 2PL9A 3O1HB 5E3JA 4ZPJA 3IP6A 4Q6BA 1XHEA 1JDNA 3LTEA 4MYRA 5IUJC 4JASB 3O1IC 4MS3B 1LBHA 4EYKA 4UHKA 3CTPA 1JX6A 3H1EA 1FQWA 3FFTA 3CFYA 5TQ2B 4N47A 4F8JA 2P9HA 1WETA 2GWRA 4XFKA 5FBHA 1XHFA 2WRZA 3H75A 2GKGA 4PYRA 4Y9TA 1PEAA 2L19A 5JNWA 3P9YA 3CZCA 2IDMA 3NBMA 3Q15C 1LJLA 1ZAYA 4KNYA 4Z9BA 5TQ0B 3QLUC 5C5EA 2HQOA 3H1GA 3O2QB 4G0QA 3N8IA 1IIBA 1DRKA 2AYXA 4LE0A 1E6MA 1Z15A 5KC8A 4RXMA 3LUKA 2O20A 3E3MA 1EAYA 3N0XA 1HEYA 3JY6A 4FE4A 2R47A 3HDGA 4RZSA 2GX6A 3KS9A 1USGA 2VUHB 5I4CA 1OXKB 2IPMA 1D4ZA 3EODA 1E6KA 3ROTA 3GRCA 4MQEB 1A2OA 2MSLA 1M2FA 3SM9A 3I09A 3JPYA 3QEMA 3UUGA 1YMVA 4Q6WA 2WWVD 4HNRA 4PE5B 5GOTA 5IULC 3B2NA 3BREA 3I42A 1M5UA 4YLEA 4G0ZA 6ABPA 3KTOA 2QR3A 3H5LA 3TMYA 3Q7TA 3G85A 2JVIA 1QQBA 2FN9A 3DLBA 2FSPA 3H5WA 1YK1A 3CLKA 3RVOA 1GUDA 1YS6A 2OQRA 3CKMA 1DC7A 5FWXB 2NT3A 4PZ0A 3RVSA 3CRNA 1NATA 3HV2A 1DCMA 2WB4A 3KLNA 4NQRA 3HK2A 3LKBA 4MPTA 4MR9B 4MS1A 2QSJA 4F11A 3IP9A 2JB9A 1NXSA 1USIA 3A3KA 4YCSA 1MAVA 3OM0A 1U8TA 1NY5A 4W5RA 1QP7A 1JH9A 1QO0A 3NNNA 1F51E 3LKVA 1AB6A 5EWMA 2JRLA 5TQ0A 4DN6A 3O2SB 3ROFA 3TB6A 1FFGA 1CHNA 4MAAA 2HQRA 1ISRA 4LZLA 3D8UA 4NV3A 3GV0A 4MLDA 4YRZA 2CD7A 2L2QA 2FEKA 2NT4A 4KMRA 5EWLA 3S99A 1QO0D 2RDMA 2QZJA 4LDAA 5TPZD 4ZMRA 1DRJA 1D2AA 1ZY2A 5EWMB 3MA0A 1ZGGA 4MGEA 1KRWA 4E7OA 4ZYLA 4YWHA 4JP1A 3JVDA 3I5AA 3VNBA 1K66A 5FWYB 1JFTA 5JNVA 1BDHA 5TPWA 3RH0A 4JB2A 2JBAB 1GCAA 5KWSA 5EWJB 1QPZA 5IUKC 2YHAA 3IPAA 5T3YA 4N0QA 3EQ2A 1Z12A 2HSGA 3RVLA 1ABEA 5ABPA 1LJUA 3KHTA 4FE7A 4OG2A 5FBKA 5IUNC 5TE9A 2FQXA 4Z4CA 4O1HA 3D02A 2PUGA 5BQ3A 4W5TA 4RY9A 3LUDA 2MYUA 3CZ5A 2PUBA 1Z2DA 3DGFC 1QKKA 4Z4HA 3MIZA 1L5ZA 4RXTA 1ZVVA 1P2FA 4RDCA 1RZRD 2QV0A 4ML3A 4EUKA 1EHCA 3HM9A 2FEWB 1URPA 1DC8A 3L6UA 4UHJA 4KVFA 5CNIA 3RVNA 4Z4EA 1JHZA 2L18A 1C4WA 2ZAYA 3NNSA 4W5NA 4RWEA 4O5AA 3O75A 2FMHA 5KQLA 3LUCA 5F64A 1BAPA 3CU5A 2M98A 3KCNA 3SAJA 2E4WA 4DADA 1JLKA 4N41A 1E6LA 1PEYA 1LK0A 3H1FA 2PUAA 3GL9A 1RNLA 2WY2D 3HCWA 4OLAA 6CHYA 2LPMA 3DGEC 4P1ZA 4XAQA 3H5TA 4EVRA 1MIHA 3SQNA 4LE1A 1NXVA 1JL3A 4L85A 4Z9AA 4OBBA 4QPJC 4IF4A 2FEPA 3T6KA 4LE2A 4LRQA 1K68A 1JBEA 1Z25A 5BR1A 5KQPA 2E4YA 1PNTA 4PEVA 4KRFA 2ZWMA 1I3CA 2W42A 2JVJA 1TLFA
chains in the Genus database with same CATH superfamily
1FC0A 3AFGA 1EX6A 1E3EA 2G04A 2QNIA 1L4KA 4TMKA 2G1PA 1VGVA 3D4IA 5A7HA 1JT2A 3ULKA 4BX3A 5AW7A 1YONA 4BZWA 3IT1A 4GS5A 1PFGA 1SXIA 2A9VA 3WY9A 1IPHA 1KZ1A 4ZCSA 1OX5A 3M8KA 3IR5A 3DONA 2YJ4A 3A58B 3BM5A 1BVYF 1LTHR 2QLTA 2AK2A 2V6JA 4ALIA 1EK1A 2DTXA 1A82A 1QCDA 1JDBC 3TQHA 4FMCF 2ZR0A 1WOMA 4IUDS 1YK0A 3MC1A 2VHCA 3ETLA 2H9YA 3WNQA 4EZEA 2L0XA 5KYUB 1AGRA 4BMDA 3EOZA 3UT5B 1R0BA 1DELA 2F90A 4Q66C 2N47A 1QVWA 1V9CA 1C3JA 2OYSA 5LQNA 3O9MA 2OVFA 3T7JA 2E37A 3HU5A 1NOIA 2I55A 4YJHA 4KU4A 2WKPA 3L82B 1LZLA 4MB0A 3KL4A 2RGUA 1ECJA 2DE0X 1KO7A 1LI7A 4LWOA 2QVZX 1L4FA 4FYPA 3P32A 4I4LA 3BH7A 4KN5A 1G8GA 4LX0A 4HWOA 4COOA 2XPCA 3G49A 4TV9B 4WNAA 3RU2A 4ZI7B 2V7TA 3RG8A 1M1YA 1Q0SA 1TB4A 2WTMA 5DF1A 1ZU4A 2ZCVA 1U63A 2AZDA 3C4QA 3H5IA 1QK5A 1SZJG 5AQEA 2A9QA 3RVRA 2AQ8A 3URMA 2P79A 4B6PA 3AB7A 2WJWA 1CRLA 3PNMA 2XITA 4JLWA 4Q3BA 4G2TA 2X5NA 1N5RA 3PGVA 4EYGA 4U7WA 3C8MA 2E7ZA 2BEJA 2WHYA 1NBEA 3SFVA 3PUVA 3I1IA 1WQ4A 3TQFA 3U4AA 2ECKA 2BJHA 1GA4A 1M2NA 1IJKA 2DHQA 3E9YA 4PX5A 2DY1A 3GJ3A 3BIFA 2ZRMA 3GI1A 2ZRFA 3OX3A 1I2DA 1TUIA 2PLWA 2PBFA 4M7RA 3K6SB 2PG3A 5BWNA 3L0BA 4E22A 3S2UA 3KPWA 1I2BA 1ICEA 3HKEB 4D4HA 4MLCA 1ND6A 1D6MA 3F71A 4R1PA 4EHLA 2HSEA 4Q03A 4PZPA 4DEYA 1MB3A 1VB5A 3PRHA 2VS1A 4YK7A 2X6TA 1VXOA 4Z3OA 4BBJA 1XUOA 1U3VA 4L72A 1RBMA 2XJ9A 1SIOA 2VHXA 1K6MA 3A05A 1K06A 4FGLA 3RLIA 2BISA 3GMSA 4TKLA 4EUNA 1DCTA 7REQA 4OK3A 5AESA 1JR3A 3MJRA 2N75A 5BW5A 1VRWA 3E8MA 4FMDB 1W1UA 5CYFA 1X80B 1MKYA 5GIOE 2I9KA 1QFMA 3ZJVA 3KOMA 1C7EA 2PY6A 2WEKA 2IEAA 3TRJA 2WMDA 4JLDA 5FA6A 1ACJA 4BZPA 2PN1A 3H11B 2XGGA 5JUWA 1KKMA 5KTPA 1Z7BA 5ECGC 1OXXK 4JWKA 5IJAA 3VO8A 2I99A 2OBMA 4E46A 3L9WA 4ZYWA 1BDIA 1WB9A 1TF2A 4S05A 5ISMA 1WP4A 1AO3A 1XQWA 3PGJA 4HKTA 3KELA 4BKPA 5A0VA 2ZUDA 3K15A 1TQ8A 1JDJA 3LQ2A 2GCEA 3IXLA 2B82A 1LFAA 4N0DA 1FP7A 6NULA 1TTTA 1SXJD 2B4AA 3IP5A 4FILA 1DQZA 2CDNA 4KN8A 4IRUB 5EKSA 1TO6A 4LK2A 5BSUA 3UMGA 1K86A 3RWOA 2PJDA 5KHOC 3WKBA 3C87A 3QFSA 4X65B 1E7WA 3SX4A 3DL2A 1IWPB 5HIMA 2BHNA 3W5AA 5CHYA 5EQJB 1G291 4MH0R 5FYDA 1I2AA 4DDUA 3KKKA 3U49A 4FS3A 1E1YA 4LQ4A 1N9GA 3TSWA 4BGEA 3V1TC 2J4DA 5A9SA 1NQAO 3HS3A 2P6PA 3I1YA 3U7HB 3IUEA 4K88A 5CX4A 3LUGA 1IZ7A 1AZSC 2R00A 3LNCA 2EV9A 1CRPA 3RK4A 1YZHA 2B8WA 2FRDC 1V26A 2I33A 5CA0B 3QP9A 1UL1X 1OXBB 2Y0BA 4TUYA 5CDFA 1GNPA 1MF7A 3ER8A 1R6DA 2BFBA 2FYTA 2VCEA 5K05A 2CYBA 2JASA 3INTA 2XUJA 3EAFA 3RYHB 5E4TA 1Y9AA 1E18A 2WP8J 2CBXA 3F47A 2WILA 3KB2A 4JODA 4QTYA 5JLJA 1EJBA 3R3WA 1JH8A 1ULBA 2MTBA 3AONB 3D6AA 3T1HB 4MUGA 2IOFA 3AR4A 4ZHQA 1ZEJA 1RZRA 2J45A 5HHTA 1W5EA 1YL6A 1P0PA 5B3LA 4MEBA 4P4UA 1G3QA 4TT8A 1G1AA 2IV2X 5DGXA 4HAZA 1ZWLA 2KPOA 5I8ZA 3LA8A 1G8YA 4U39A 1XG5A 3TEJA 3GAZA 4OL0A 3B1ZA 5CCBA 1G3UA 2RK4A 4K40A 4Q37A 1R6AA 2VQEB 4MUFA 2X2FA 2TECE 1MB4A 2C2MA 3HUEA 4JUAA 2GZHA 2FFRA 2VP6A 3PXBA 3VI3B 1C2TA 1EDEA 2YIDA 1M6VB 2R8BA 4HGOA 3ECSA 1DWPA 2WFLA 5DTJA 3S2FA 4QOFA 5KOIA 4R16A 1VBFA 2QS9A 1GG2A 2E5LB 1SURA 3JRWA 5JD6A 4R7ZA 1KI9A 4TTAA 4CFSA 2I22A 1JF8A 1HDRA 3HO6A 3GLHA 3NUQA 4O4IA 6AT1A 3KR9A 4Q9NA 4KWIA 4PN7A 2N9UA 1GPDG 1HRKA 1VSBA 1X7GA 2GK3A 3VFDA 2WQ6A 1AF7A 4ZVSA 3ZYCA 1QUFA 3OM9A 3K1AA 4ZIRA 3H86A 4BKQA 2BM9A 5IKXA 4MV6A 3RGWS 2NQTA 2XECA 3BK2A 5LDGA 5JXJA 4O3MA 4DLTA 4IMJB 1ZCJA 3FSGD 3UJDA 5J4KA 3EXG1 1ODTC 2C2ZA 4P8RA 4WESB 4BN4A 4FFBA 2WNSA 5BSFA 2C42A 3C3CA 3O8BA 1DO8A 2UXBB 1T2VA 2HRDA 1UBOS 1WVIA 1E4OA 2GN6A 2JBHA 2Q4TA 1N6NA 1E7SA 1RRGA 2Q4OA 4MI6A 1H93A 1SBCA 3VDXA 5KWEA 3B1WA 3H9GA 4BAUA 4ZK6A 4EMUA 3P0RA 2O2HA 1I9GA 1SOUA 4G1CA 3WL8A 2OZPA 1KH2A 4ZGBA 3ZZUA 1IONA 2ZM5A 1F8GA 1E5LA 3EARA 3HB0A 4L8FA 2GBPA 1J00A 2ILVA 3K1YA 4YQYA 2UXDB 2ZFUA 3VSEA 3JAWB 1W47A 4RJLA 2JVKA 2CXRA 3OZTA 2AYYA 1H2HA 5F4ZA 2FPIB 2BTQB 2DETA 1L4LA 1XZIA 5GJCA 4IJQA 1EB8A 3WQQA 4JBLA 3TZQA 1KR5A 3G02A 5LP6C 1BXZA 5ED0A 2Q5JA 2W22A 1YB5A 5KYKA 3ZNQA 2FMTA 2CFOA 3L02A 4FINA 5HMLA 4KH1A 4P2GA 3T9DA 2XA1A 5JE8A 4CM9D 2OECA 2VNHA 3D0RA 1L5HB 3MJ4A 3WZLA 2JFFA 2KYRA 4RQAA 5HZKA 1RJ9B 4E21A 1WSDA 4ZANA 5FCDA 1TQ2A 2VUIB 3UVEA 2P7IA 3QXGA 3VR2D 3WO1A 3GNLA 2X0EA 2IS6A 1MHPA 2AKYA 5LQDA 2A9PA 4RD3A 1II9A 1W8IA 4E33A 1TQHA 1AOXA 4OJYA 3UMSA 4RFVA 3TGPA 4A8JB 3RK0A 1ZKDA 4ZEOA 1UQRA 2ATEA 3FH0A 4N49A 2VUSA 5C4MA 1R6TA 5TV2A 5I01A 3M4YA 5FO1A 3IKJA 4MULA 4KDEA 4PZAA 1HLFA 3UJ9A 2PH1A 1QGUB 4BO7A 1H9AA 4XUGB 4MUIA 3O91A 2ID9A 4CODB 2VJAA 1YZYA 2Q6KA 3V4SA 5I8PA 1CJBA 4FW8A 1H2WA 2V8OA 3FOBA 2I6GA 3ZD8A 1GG5A 1XWWA 3ELYA 3VR6A 4UEWA 1RZVA 3VU8A 4TKUB 4OQFA 4RABA 3ZCSA 5L3SA 5ALGA 5HR5A 1DIBA 1CRWG 1QGZA 1XJWA 3PEUA 1L5MA 4WIAA 3IODA 2HWWA 4NYIR 4AKSA 3WK5A 2WUGA 3I2HA 3L8DA 4G8DA 3QPCA 3H13A 4ZPJA 1GTSA 4JLAA 4HYTA 4UQOA 4C29A 4IHJA 4MS3B 2HJHA 5G0UA 1MRZA 5JS8A 3DBLB 2VHWA 3H84A 1BE6A 3KWLA 2D13A 4LXUA 1FMFA 3MWDB 1BHQ1 1HFEL 2BW0A 2Y4OA 2ADFA 3A32A 3AG6A 1R50A 5DRTA 4ZAGA 3Q5EA 5A04A 4C4AA 2CEAA 5J4HA 1JMYA 1IVYA 3HJBA 4WLOA 1AK9A 1PJAA 1WIWA 4IIBA 3KZOA 4X7BA 3TW6A 5JQWA 4XDGA 1G8PA 1YR1A 1SVKA 5FUYA 3KTFA 2ZIAA 2YJ3A 5C3MA 1LGYA 4UOQA 4F4CA 2Q4DA 4LYHA 4OK6A 2VJDA 3F49S 3OPYI 1UMDA 3GP5A 1JXAA 2GK6A 3JYOA 2OM6A 4IWNA 1H1TA 1B26A 3M5WA 4JUIA 2I4TA 4GC5A 4MIOA 4R9VA 1YVDA 1HEYA 4H6PA 3C6ZA 1EBFA 3C45A 3NTLA 3ZJ4A 4D0GA 1OWOA 2B3DA 4N54A 4Q15A 2YV4A 4A82A 2AB0A 3A7DA 3AB3A 4EX6A 5J2TB 4OIFA 1PCXA 3CT6A 5AJUA 5JTTA 3QA9A 2RH8A 2YUTA 3R8XA 3MGAA 4HHEA 4N9QA 2C9YA 3CPHA 3JPYA 4OKSA 1W6RA 1NT2A 5HKKD 2WWVD 1MEEA 3ABRB 3B78A 3GEEA 4M1ZA 5AHRA 1H2AS 1VA4A 4C6TA 4XD7A 2DBZA 3T7CA 4JKOA 1H0KA 2VWHA 4BNZA 4JYCA 4CM4B 1GZDA 2G8LA 2PUVA 3EZFA 3Q0IA 4IJMA 3MEQA 3QFCA 1N9GB 3QVJA 3T3EA 1LNQA 4LHWA 2IHZA 4AZTA 3KT3A 4JUBA 2P8SA 1E3IA 1M7GA 3AR5A 4N7RA 4UBJA 5JVDB 3GELA 3WOVA 2FPIA 2BTQA 4YJ2A 2AWNA 4FCWA 1OX4A 4C0BA 1EXMA 4OQ4A 1QYDA 4JBGA 2ODTX 3OCYA 3T06B 5C37A 1F12A 2GN8A 3ZE1B 4N5DA 1GSIA 4A2CA 5IU6A 1ISIA 4JLUA 4IDBA 4LC1A 3WHLA 2BKLA 4YJFA 1RQGA 1QZUA 4L95C 2ZBQA 4HFMA 4CTOA 1XNGA 2XGOA 4B5LA 4QGFA 4YUWA 4W5RA 1QO0A 5BV7A 1RKVA 3OWOA 3HABA 3LKVA 5SY9A 4F4UA 5KJ6A 4RCZA 5F1YA 5CJ2A 3TBHA 3CLUC 3EA0A 2HBRA 3GEHA 3O2SB 3RYIA 4D56A 3JR7A 2NMVA 4MAAA 5LDDC 3RJ9A 1L8AA 1B41A 1VG0B 3K73O 1SQSA 3BEDA 3JZAA 4CIDA 4DJEC 3E22A 3OQ6A 5FPPA 1JG4A 1RXUA 3VOAA 3BZUA 1GFZA 1YL7A 3TIGA 1CWUA 3FWHA 2PGJA 2QIOA 1OU0A 3EXEA 3JZFA 3Q6IA 3QKSA 4MLDA 3YASA 4D9IA 4CM6A 3UPDA 1QV6A 2C2BA 5GOZA 2FPOA 4M36A 5EJAA 5BO5A 4BKUA 1U7TA 1ABBA 4WSOA 3I1FA 3PQDA 1CULC 4ZAVA 5J47A 4L22A 4IP0A 5GWXA 1N0WA 2R6R1 2PQMA 5FWYB 5HTOA 5DN6A 3T41A 3A25A 2LCFA 1UZNA 4UCWA 1D07A 2IDKA 2NV2B 3IQFA 4GEGA 5KYGA 3UEOA 2HSGA 2YICA 1XZPA 3PLNA 4MUXA 2GPBA 2MINA 3GY0A 1GTL1 2JH9A 4BTLA 1JAXA 3KIPA 1T9KA 1JSZA 4XM1A 2OY0A 3ICPA 3TTWA 5CLHA 4W4TA 2JFGA 4Z4CA 4CQNA 3DE2X 1RYBA 2FWBA 4H7DA 3I5XA 4UVIA 2IXTA 3BWVA 3N6RA 1FFEA 3WBBA 1P0IA 1XD8A 1G1MA 2H5IA 3DWEX 4OI1A 1KQPA 5B6JA 5CCXA 2PGLA 5KSOA 5ALIA 3PC6A 3ORYA 2KWIA 1Z2DA 1OI2A 1OTHA 3T3GA 1FDWA 2GEBA 3RC9A 2WA1A 1GZ4A 3OZIA 1XFAA 4YWJA 4RTQA 2EP5A 1NSFA 2FV8A 1YBMA 5BOSB 2HR1A 4P81A 1LV8A 1N6PA 1YHZA 4M8SA 2NO7A 1FRNA 4OSEA 2X76A 4NZMA 1QAQA 1GPWB 3KQQA 5EUQB 1XN1A 4IZ6A 4EKYA 3CU5A 2IIPA 2VC2B 4LYAA 3SAJA 4N41A 1KDZA 4JN6B 3TG8A 1L9KA 4NSNA 4PM4A 4OHWA 3P9KA 5DP2A 3KHKA 3ZWYA 3ZVLA 4EUFA 3A2LA 3COYA 3RWMB 4Y2TA 1I4DD 5F52A 3SQNA 2I7VA 3NHYA 4FFDA 2DQYA 4B6OA 4NRDA 3NW9A 3SEZA 2HK9A 5HOEA 5SYNA 1GDDA 5GZ1A 2F6RA 3SCZA 2PU5A 1W5BA 2GRAA 2YZNA 4GSLA 4AYTA 4PEVA 4D79A 1ODCA 1PG0A 2P4EA 4L9RA 4OD0A 4RQTA 4HMQA 4XB2A 2E82A 2R5WA 2QZ4A 2B6NA 4HDAA 4JUCA 5EESA 3B3FA 4JU8A 3CRQA 2HQBA 1DFGA 3VZRA 1ISMA 2BDTA 4KMOA 5IAJA 1CB7A 3AVUA 4OQQA 2BEVB 2HU2A 5IJWA 3IEKA 1EM8B 1M6WA 3FYTA 1OV6A 1YKFA 3MCVA 4YJGB 2FSIA 1V8DA 4H1VA 2IXEA 1YGPA 4X90A 3WL5A 1L3CA 2QD4A 2PGNA 3HXPA 2YHBA 2P0AA 3TLYA 1OA0A 3ROEA 3L1HA 3UW1A 2VH2A 4MW7A 1AO0A 3OZWA 1L5QA 2CNNA 2AOTA 3OKFA 3U0VA 3WSWA 2BYTA 2ZUTA 4EWLA 2ECQA 3SDZA 3HYRA 1PT7A 1JYFA 4BZXA 2NZ8A 4ZOBA 3MYRA 1ONBA 2GBLA 3WL7A 1NJFA 4BQQA 3EWAA 4O4LA 5B37A 3R7DA 4XQ0A 3EE6A 5LYJB 1TJYA 2XNSA 4IUBS 2CVQA 1QIDA 4GR5A 3ZWXA 4CCWA 1T4CA 2CCGA 4QYTA 4LXGA 1Y6ZA 2ORWA 3BGVA 1XL1A 3MJFA 1B6RA 1Q12A 1IMOA 1QPBA 2X5JO 3BCHA 4FE3A 2BIFA 1GO2A 1RAFA 2OO7A 2VIIA 3FRJA 4J0FA 1Z47A 1NYQA 2ZS8A 1Q7EA 1DPFA 3HGTA 3C7CB 1UT5A 2FUG6 3GO4A 2YV3A 2AJCA 5K5EA 2BEWA 4LGMA 1XYGA 3COSA 4YXWD 2ORIA 1A9SA 3BTSA 1PYOA 3EZXA 3GIWA 5A9SB 2YN4A 4KXQA 3MBOA 3E9NA 3OCWA 1U8FO 2BKEA 2HJSA 2A4MA 1WBDA 1CXZA 2WM8A 1GLGA 3C14C 4C22A 2J87A 3HY3A 2YW2A 2OC4A 4QBGB 1KC1A 4DMUB 1A4UA 2VA8A 4IIJB 4FZ3A 4REQA 4P33A 4NPCA 1SCQA 1VZ2A 3W3AH 2ZRKA 3HBNA 5IDQA 3OA0A 3UW3A 2QPLA 3B1XA 3CCFA 2C94A 3ZCVA 4BO5A 1A8UA 2I2WA 2ZT8A 3PCTA 5K0BA 4C4OA 5FL7A 4R9RA 4D5EA 2JD2A 5DTEA 4PICA 1YCFA 4O1IA 4MS1B 2EJBA 3KLOA 3VC3A 1BE8A 1YOBA 4PXSA 4O8CA 3VH4A 3SSAA 3OBBA 5TT1A 5IJZA 3FW1A 3I39X 3F6SA 1Z82A 1X14A 3M6AA 4UBLA 1UWCA 1EFTA 1FFAA 5CK4A 4NF2A 2YOHA 3A28A 1SHKA 1ZX1A 4BFXA 3ORFA 3DBRB 2GESA 3OTHA 4N5LA 1DJLA 2X8BA 3AYXB 1F2UA 2NTNA 4TL7A 4E7PA 4JBIA 2JGRA 3OT1B 1ZJYA 2O07A 4HDQB 2XE7A 2YRXA 5LFAA 4PC3A 3HCPA 1DG1G 1FYDA 4QNRA 1G6KA 4QBFA 1Z0AA 3T4EA 3BWCA 4Q3EA 3U3MA 3CEPB 3NDJA 3VR4D 4TTTS 4MVJF 3LLSA 4K2HA 4H7JA 3RV3A 4CKWA 4TSFD 1YI0A 3H2HA 1SPBS 1ZD4A 5KVQA 5LYJF 3VSDA 1K4KA 2P78A 4AECA 3DWIA 4XDHA 1QV7A 4XD2A 1RCTE 1OWMA 1HUQA 1DJPA 5CX1B 5JO0A 3PXDA 4CKWB 3KUCA 4D3ZA 3H11A 1U1CA 2Y67A 1JLSA 1MJHA 4FD2A 4JVLA 4FGWA 1H4VB 1U0SY 4MYSA 1KWGA 2EW1A 3DE1X 3P19A 1YQTA 2VPIA 4BNHA 3LCCA 1KY2A 3AHIA 1Q1GA 1V11B 5EP1A 5EJ8A 1BDBA 3V55A 3ZOKA 4MV0A 4PO1A 4RTSA 2AI3A 3CVVA 3BAFA 1LEHA 1DRUA 2GERA 2QYSA 1RRVA 2HM7A 4BLVA 4EL0A 4FOTA 1BMFA 5HZHA 5AW2A 3QQPA 5JS7A 4KC0A 1KTVA 1V11A 4K9MA 4EENA 2AXQA 3OE1A 3HA2A 3NT4A 5JI2E 1U7OA 2VT3A 2UYCA 3A10A 3I9NA 1GAQA 1PJBA 3O2JA 2PLFA 3ND8A 1RWBA 2HSZA 1Z2AA 2A9JA 1LW6E 1NDQA 3ZNPA 3NI2A 1VP9A 4UUBA 2XMSA 5K8TA 2KW5A 3RVBA 3WS7A 2Q9UA 5I8WA 1O5IA 1O57A 2EFCB 1O8CA 1KO8A 4V1CB 3EDYA 5BR4A 1N92A 2YC2C 5G41A 1GV0A 4QXPA 1MFPA 1RC1A 1T9DA 1YACA 2FPXA 3JWHA 2LW7A 4FOPA 2FVYA 3MMZA 4HDSB 4PGMA 2P4UA 4QUEA 2J9FA 3M6LA 1KZ7B 4U2DA 4WPGA 5LBIA 2OQVA 2CY0A 4MMZB 3LS2A 1SCAA 2CHUA 1GPYA 1UOPA 5JXHA 4R2IA 4X5OA 2HK6A 2WABA 3MHTA 4I5IA 2V8BA 2ADOA 2PUCA 1JAYA 4U00A 2ZJOA 1B42A 2F64A 5CFMA 5IG2A 3PDJA 1MJNA 1TJPB 4J2TA 3V1NA 3PVCA 4GXQA 4MO2A 1Q21A 1T1RA 4X54A 5AJWA 3FOEC 4CDRA 4WDRA 3FPHA 5FLYA 4H4DA 3GLQA 721PA 5I9IA 4ZZ2A 1KO5A 3DDNA 4BNWA 5ESDA 4E2XA 1J5EB 2POQX 1IUOA 5AI5A 1DC5A 4HWTA 3PPWA 2XDAA 3D3WA 1NJGA 2WAYA 3L49A 4NHEA 5ENDA 2V7XA 2A9KA 3OVMA 1NUPA 1HMYA 2C03A 3E9QA 4IIEA 4WNYA 5K6RA 3OMXA 1CUAA 3R7FA 1WU8A 3IXMA 4W1SA 1AUXA 2QTCA 4BB6A 4EA6A 3OZVA 3HXMA 1KJWA 1E9RA 4LJAA 3EW9A 4JBXA 3GP8A 3QSYA 2PXHA 5DYYA 3L46A 4LOHA 2WPDD 1F6BA 1SJ9A 4RJIA 5HDBB 4F04A 4X20A 2C8VA 3M82A 2NU8A 1VZ3A 2C3OA 3KKLA 3CF6R 4Y2XA 3RTEA 2PUDA 1NW9B 2Z3ZA 1PJ2A 1T8WA 3MMSA 1PGPA 1IEXA 4DM3A 4F56A 3GFPA 3NWPA 5BQOA 4ED9A 4MW4A 1GAEO 2O3SA 4EK9A 5CT5A 4F1JA 3RS7A 4RIEA 5IWAB 1JA0A 2OBNA 4OP2A 1HWYA 1JPUA 3OJEA 4ZRDA 1T9BA 1YRAA 1QS0B 3BIWA 3IHKA 1ST3A 3O74A 4Q7KA 4QUIA 3SYTA 1EHIA 1QDLB 2PGAA 3M3DA 4C4RA 4DLYA 4PPQA 4PGGA 4YDHB 5LOVF 2CSXA 4P5PA 4FFOA 3V8NA 3RM3A 3CUVA 1XD2A 2WUFA 2JGIA 1MNQA 5KEIA 2EZ8A 2G1KA 2PV7A 3U9TA 5BNWA 3VR4H 3I6MA 4ODIA 1OILA 1MO5A 3PHBE 2VXOA 3TVYA 4CRWB 3KQUA 3KQSA 4BNTA 4RORA 4QQKA 3RREA 1J09A 1SCJA 1G5QA 4FS8A 3K9CA 4MICA 2NU7B 4HQFA 3W2TA 2AN3A 2WJ3A 1D8TA 2ISCA 5KX5B 4IIVA 1AZTA 1R4ZA 2NTVA 4P3KA 1FJXA 1NNI1 4DDHA 1P2DA 2BEKA 1VHLA 2ECOA 2PR7A 2JJ2A 2PA3A 1QZZA 4YRGA 2Y1GA 4QDXA 4NMHA 1EJ0A 5IP5A 4FFSA 4WTOA 3ZHTA 5AVVA 1N6OA 4EHJA 2BEUB 2CXXA 4AP9A 1GNVA 4NAVA 1XD9A 2CLCX 4DG8A 1ZHOA 3FPJA 1C3XA 1M1UA 1B0AA 3T8YA 1Y33E 4B7CA 4WY5A 2RHOA 2H4HA 1GP2A 1SA0A 3DO8A 4ZT6A 3WGOA 821PA 4TYMA 1RXVA 4WKPA 5A4MS 2QXYA 1PV2A 4YRBA 5BRAA 2JFPA 2VR1A 3WAJA 4GLOA 4K9KA 3ZHSA 1ZESA 2R60A 4FDAA 2QE7D 5PNTA 3VPFA 3DS8A 1FTQA 4RPJA 5CFOA 4EYQA 1Z35A 4OFWA 1X1BA 3IT3A 3DZGA 1H65A 5T57A 4PS0A 1DAMA 1E20A 2XHZA 2NNWB 3MTQA 4OATA 1T0IA 4O4JF 4BJ6A 2A0KA 3RBVA 2I5PO 1QHFA 3HTXA 2FP4A 3EMDA 1H2BA 1YBAA 3QPAA 1XLVA 2JIDA 3RYFA 4JBHA 4PZYA 1V5GA 1Z4LA 2C00A 1ESDA 1QR6A 2WYWA 4DCJA 5AVYA 4KPFC 1FNSA 1XEWY 2FFBA 4KRGA 5T6BA 5T4EA 4K87A 1Q1EA 1RQPA 3PDUA 4JVNA 4OHRA 4F8JA 4WVLA 1R8XA 4DLZA 2G5CA 4K0RA 4H77A 3T0GA 4FLFA 1WETA 1KDRA 4KITB 3FVRA 5C1IA 3TO5A 4EHHA 1XYYA 2WSSD 5ALDA 4KXVA 3E2PA 3AF4A 4B5KA 5C81A 3EEIA 4ND3A 4DWJA 4EMTA 5H4GA 2EARA 1TQDA 4WBXC 1N8NA 2Q5LA 4LN1A 3NBFA 2W8BB 2A0FA 4JU9A 5KC8A 1W36D 1M7HA 1E94E 4S1NA 2WZDA 3ABIA 3WDKA 1YKGA 3ZJUA 1XTPA 2ACKA 2RCNA 4EHAA 3ZHUA 2GPYA 4L15A 1O95A 1U5BA 1JE1A 1VI2A 2O2CA 2QD2A 2QNBA 3A7EA 4M0UA 4NFLA 4RZSA 2UYOA 1OXKB 1Q0TA 4PSVA 4U6QA 3ROTA 1BGWA 4QJBA 5IMSA 1HFWA 4ICIA 1E3MA 1DX4A 3V4FA 3ZU4A 1QRAA 1WQ3A 1L1RA 2VSFA 3QEMA 2IYEA 1XTIA 1LI4A 1O96B 2DFPA 2QTFA 5ECWA 4B4WA 1KFKB 1I36A 1G8KA 1SUAA 4MQ6A 5IAEA 3U3OA 4BJ1A 4RX1A 3TLBA 1SQFA 5JAZA 2VJQA 2CVOA 4KI7A 1J8YF 2HBYA 4ZCPA 3RGGA 3D4LA 4I5EA 1J0XO 1BROA 4JSYA 3VTAA 1Y3CE 1BDMA 1RWPA 4QVKA 1E2FA 5EFOA 2BFFB 2OG2A 4KODA 1YQGA 3V3KA 3L06A 2WICA 2ZB7A 4EO4A 4B76A 5B6IA 2BGKA 2D4AA 2IPOA 2OQRA 1M76A 3L40A 4BB0A 4B3MB 3CWCA 1Z3CA 1DC7A 3G6KA 3HSKA 5GVRA 4RM3A 2B92A 3D3NA 3GVCA 3O4VA 4LJ6A 2QMOA 2HIGA 1WW3A 2DHDA 2ZG6A 4FT2A 4U7JA 4NV0A 2VZ0A 5F5LA 4Z2YA 1XNJA 1O5TA 1I32A 2W6NA 1VKJA 3BWDD 4I9FA 4H16A 4LOIA 3L6BA 1P7WA 4MW0A 5EXXA 3WJ1A 4BFYA 3HVKA 4GKBA 5FPKA 1YQ9A 5JECA 1JKMA 4F11A 1UQUA 2ZAOA 4H59A 2W2XA 5H82A 5CFQA 2ZAIA 3I01A 4IUCS 1PT6A 1MAVA 1PLJA 3W9BA 1TJ5A 1Y1TA 3HGMA 4HDNA 3ITEA 4JC0A 4RQUA 3CUUA 5EP4A 4D4JA 5JVDA 3LM8A 3SI7A 2ZS7A 5JCJD 5LNK6 2WT4A 3J7TA 1FPMA 5A5DA 1ISRA 1RLJA 1ZKMA 1T43A 2VXBA 3TNFA 5B4VA 1EUDB 2D5CA 2GAIA 3DFFA 3Q87B 4RYLA 1G8HA 1GT91 1PZEA 3QVXA 5G1NA 4B17A 2XTZA 2P8JA 1Y1SA 1RWWA 3GDOA 5AQ1A 1DEAA 1XZQA 3OZBA 1L6IA 4H6VA 5JFTA 2PS9A 1NUTA 1E1CB 1X7ZA 2WE7A 3GPCA 4OA8A 1KRWA 3CKLA 1E98A 4I66A 2BMVA 3G5UA 4LBZA 4Q1AA 1K66A 4L5BA 3ZU6A 4B3FX 2IJGX 4AI6A 4C4XA 2PS0A 1FF9A 3S29A 4EKNB 1IHOA 2DQ4A 1SUCA 2G36A 3DWGA 4P36A 5IH3A 3M0EA 4D81A 1XMQB 2IHVA 1X7ZB 1GADO 2RG1A 3I53A 5ALNA 3RRNA 3FUWA 3HI6A 1CBUA 4M0LA 1YZLA 4G9BA 1ABEA 1TFRA 3RTAA 3WLTA 3CRRA 4X97A 2B1QA 3EPHA 2WE8A 2XQJA 4EHKA 4HH3C 3PXCX 3UOGA 1AGNA 1OBOA 4D0LB 5ALPA 4OSOA 1LTQA 2F1RA 2P27A 2Y1WA 3DDHA 5J5AA 2BFEA 3W7AA 5K6TA 3CJRA 4Z5XA 4IVNA 2OHGA 2GD2A 1NJ8A 1Q91A 3CZ5A 4CQLB 5J4LA 1AXEA 4X63A 4FBLA 2C7RA 1N1MA 3D1LA 2ZBUA 2OL4A 3MT9A 1MXHA 4GD3Q 2X14A 5F9HA 4EB6A 4O4JB 1E1LA 1V8ZA 4U2KA 3AF3A 1XMVA 5EIBD 3CX6A 1WZEA 3F9CA 4NZ9A 2IZOA 1P74A 1S8AA 2XIQA 2YOGA 4P2BA 1ADBA 4UATA 5CA1A 2A3NA 1JECA 3ER6A 5LM3A 3E8SA 4AN1A 4TKVB 4DNPA 2WYOA 3KEOA 1NPDA 2GM4A 1CQIA 5GGXA 3TXAA 1Y3AA 2ZYTX 2V7UA 3JQBC 5F64A 1P77A 3ZI4A 2V0CA 2XNCA 4JLKA 5CAEB 2WTEA 1NC1A 4UAUA 5LJLA 5DASA 2A5DA 2QGZA 3DNMA 4OBEA 1QQ7A 4UMEA 3NVMB 1Z33A 1L1EA 2ENUA 3LY5A 2J1LA 3M81A 1GNQA 4JJ6A 4IIFA 1R1DA 4O4LF 5CAEA 1G98A 2AK3A 5DBFA 3TTXA 4IF4A 3DNPA 3FIJA 3HVUA 4YACA 5EXPA 1UPFA 3NONA 1JBEA 3K70C 1PR6A 3PEWA 1D3AA 2ZWMA 1AH2A 1AXGA 3KP1A 1DQPA 1KKLA 3DM5A 1CVIA 3RSOA 1MIOB 3NHRA 1Y3BE 3LCJA 3VO9A 4YQZA 2OXEA 2HTFA 4QJ5A 4WZAB 1YF3A 4NENA 5FO0A 4CPDA 4BXOA 1Y6FA 1QSGA 4ESVA 3JAKB 2QTGA 1Z5PA 4YCNA 2K6GA 1EXDA 1X3SA 1YR3A 2P9TA 3IPLA 5ILOA 4DRXB 4L0QA 4ZREA 2QTVB 1X1QA 1KRXA 3IRVA 1NXPA 2EJCA 2HCTA 1AQLA 2YJ6A 3ON5A 4S04A 4NDAA 5F3DA 4B6GA 2QDXA 3FJYA 4KFCA 1ICIA 4M9ZA 1R27A 1T9ZA 3CZ9A 5CVUA 5JWRA 1Z5NA 2WW8A 4MR7A 4Q82A 4C7XA 4RIIA 3QVKA 3H5OA 4CLRA 1P4HA 3GVHA 1PT9A 5BWLA 3OPXA 3KJEA 1O0CA 2JCVA 1OLSA 5DBEX 4DKXA 4UTPA 4EPXA 3VYRB 3VMMA 2E4ZA 1HY3A 3TEMA 2NVBA 2EJWA 1XR3A 1K5GA 1E0SA 5LZ8A 5K4HA 1IC6A 2J6CA 3PQCA 1DKLA 1XP8A 2AG6A 4WBSA 1JGTA 1YJAA 5JNSA 1N7IA 2QUZA 1GUZA 4H9GA 4TT3A 3OQMA 5AOAA 4PANA 3O92A 3HBFA 2A1TS 2R1VA 3T5CA 1QTRA 3WNVA 3ENVA 10MHA 1U80A 1SUSA 1HLPA 3TVDA 2D1FA 1L5WA 3RRYA 2JFNA 2OFWA 1P5FA 3VDMA 5L7TA 1EUQA 1E8DA 1WRBA 1P5RA 4YYEA 5HF6A 1OTYA 1NSTA 3COWA 3PXEA 3GLGE 3HZHA 3HDVA 3P5BA 4NZYA 4F4JA 5DMXA 1QKIA 2ENWA 2VCHA 2F62A 3AI1A 4EECA 2QSUA 5AUPB 3FPFA 3BHIA 2CBGA 3ZI7A 2E2WA 1BVUA 5I47A 5IT9A 1D7OA 2WM2A 1YFLA 4KR7A 4LDRA 2OO5C 2XQKA 3E7FA 5EI5A 1D5CA 3E7XA 3BE5A 3FYUA 1OI7A 2E6UX 2RKOA 2QY6A 4BIIA 1MCZA 3X2FA 2Q0HA 3W2GA 2VH5R 3AXTA 1N2IA 1RKBA 4AX8A 1QIFA 1AKRA 5KCMA 2ZOSA 4B43A 2TSYB 1MABB 3HNRA 2ES4A 5EMMA 2F8LA 2IPAB 1K2WA 3EWNA 3DTVB 4K26A 5LYJA 5AKXA 4ARCA 3GDWA 4QLAA 3MGGA 2OBYA 2VXCA 1I7NA 3KB1A 4IGFA 2PZLA 2GCNA 2B5WA 4KYVA 4CDNA 5FH9A 1GKUB 4UNQA 2JFHA 4AUKA 9MHTA 3VHXB 3SVLA 1P0FA 1AK1A 2FPMA 1HOTA 3LDGA 2HHCA 4UU0A 4ETMA 4ISBA 2W71A 4KQ1A 3EN0A 1CYEA 2QG6A 3FPSA 2FOLA 4OPMA 4MS4B 2PFSA 2VJMA 2GF9A 1L7VC 3I4LA 3TIFA 2J9YB 3MWEB 4D6YA 4XIYA 4ID3A 1DKPA 3IAXA 2L42A 2EP8A 4ND8B 3CHYA 3ZX4A 2X5KO 2QJFA 3P0FA 1GN8A 1JKIA 4YROA 5TPWB 1JIKA 3LPLA 1BXGB 2DFVA 2FN3A 2QI9F 5DYGA 2CC2A 3WDSA 4MKRA 4TMYA 2LIVA 3MWEA 1WSBA 1YRHA 4B3SB 3JQ8B 1CEYA 1BMDA 2FKAA 3PZRA 4S1TA 2BFWA 1FX1A 2J41A 2J9RA 2O2DA 1LX7A 3EQZA 1DI0A 3IMGA 5G4KB 4CUJA 4ERNA 5EJ9A 2MR6A 4DCOA 1BNCA 2CLLB 2DULA 1JFRA 3C0KA 1D6SA 5DH9A 1KTIA 5JFOA 2DZDA 3LU1A 2X2PA 1EUDA 2MSDB 2A1UA 3OFKA 4FWIB 1NMZA 5HYVA 2AQIA 3T9FA 3DZHA 4S1WA 1Q1QA 2XNDA 2VHJA 2I6XA 3IQDB 3UKJA 1PK9A 3GLIB 2YW9A 3EUWA 1H5UA 3DAYA 4UEKA 1ZIPA 3T9CA 4RPGA 4G5QA 4K6FA 2JH8A 5HSGA 4FZRA 5JZ9A 3HNOA 2FMKA 1BXRA 5FI1B 4KAAA 4MHSA 4RANA 2ZB2A 4DV1B 3RT9A 5KSWB 4C0AC 1K7FB 3V7NA 4IINA 2IELA 2PZMA 2D1SA 3PUJA 5AIBA 2YVLA 2DT5A 3CRZA 4HOYA 4FFNA 1TT7A 4EABA 3HVRA 1UMCA 3KU4A 1PJSA 4C04A 4OKNA 2JLWA 3B3GA 4RY8A 1U0RA 1UDAA 3KT8A 4B6JA 1GPBA 4I1RA 4LXHA 1R0LA 4FQ5A 2BFEB 2D0PB 2Z9BA 4II3A 3WADA 3B5EA 3DAHA 2Q62A 3V32A 3RROA 3TLEA 2GCOB 3F6PA 3OWHA 4I9GA 3TLMA 1QU3A 5AP9A 2QX7A 1NBMD 2VQFB 5I9NA 4FSHA 4ZQHA 1E2JA 4RK6A 3DMDA 2FZLA 2GR9A 3BSFA 3WKDA 5JS6A 2I4MA 3UKDA 4HNGA 2ET6A 2EDCA 2J48A 5JCJA 2IDZA 1WEKA 3QEBZ 1G3MA 4B3GA 4E14A 1BS1A 4UU1A 1EUYA 5E1MA 3HKDA 3IVCA 4KXYA 5HW0A 1CEXA 1LC0A 3JQAD 4NYJQ 4S1OA 2PYZA 2WQZA 4I81A 2GN0A 3GP3A 3HFGA 4XWYA 4ZC1A 2DR2A 1DV2A 3FF4A 4INZA 3MD0A 1XPJA 3JSXA 4G84A 1HRDA 1FFSA 2GZSA 2YBEA 3ETGA 4UASA 1CDOA 3L01A 4OXRA 5DCLA 1M67A 2GASA 3MMNA 3C43A 3ELWA 4QYMA 5DBOA 5EKXA 2VJBA 3FCUB 5AVRA 1HDXA 2ID7A 3GUUA 3ICWA 3M6VA 4GMDA 1TMKA 2QM7A 3FDFA 4IFTA 5AUQA 3DMTC 3UJPA 2RH5A 2B8EA 3M6IA 2FLKA 1ZPDA 2QPOA 4GYWA 4M22A 5AM0A 4MI9A 1DQRA 3MOGA 4NONA 1Y9DA 2HT1A 1Z0IA 3ANTA 2ZJFA 4ASUA 3OE4A 1ODIA 2QZZA 3IA7A 5JAHA 2ZJ6A 5IN4A 1EI9A 5JSQA 3OT4A 4HDKA 1FSSA 4OF4A 3OZSA 3NHJA 2FU5C 3JASB 3PFWO 3ZBQA 2BGTA 3CQ9A 4X24A 3CNOA 1ARZA 4EEXA 2OKGA 1ZP6A 2R8RA 2ZB4A 1Z4MA 4FJ2A 3PI6A 4R5MA 2HUPA 1GRNA 2CFTA 4PNPA 4ZQBA 5JDIA 1FA9A 3PTZA 5CIQA 3DB1A 3AOEC 3V00A 3B52X 1UAAA 4OXKA 2ECPA 4BP3A 3SBXA 2YKGA 2P9JA 2H1WA 5DIZA 1FSZA 1QOZA 2HZ7A 1T10A 2OSBA 2ZUVA 2W83A 3FPCA 3GD5A 3BBPA 3ZQUA 3BE6A 1ZLXA 2XXAA 4XVRA 3LW7A 1Z4OA 4ZYZA 3QI2A 1CZKA 1JDVA 3R7AA 3ZK8A 4M0MA 2CF5A 5H16A 3TBFA 1H94A 5DTQA 2W2TA 3W2HA 2P35A 4CFZA 5HKBA 3Q8KA 3I9MA 4BN5A 3NUZA 2JCSA 3QEMB 2DR0A 4WJLA 4AVYA 1FRVA 3PITA 1JEOA 1RU3A 3HU3A 5EYPB 2DUNA 3H18A 5FUMA 3WRYC 2VTBB 1UZAA 2DUUA 2O8CB 1KFJB 5JJLA 3NEJA 3CN9A 1IMJA 2G83A 1JVSA 3A6FA 3AKEA 1OPXA 3ICOA 3N8GA 2IK8A 4ZODA 3H2YA 1W7AA 1TZJA 3KJFA 1YJBA 4P7KA 1GQRA 5DOZA 4NJEB 1IWBB 2E9SA 2XVAA 2ID8A 3CSUA 1GTG1 3OO0A 4HLQB 3CWZA 3U44A 3VSCA 3FUUA 5I9SA 2DYKA 1C9DB 3PQ7A 5U1PA 5K7SA 3BIJA 5AVQA 1Y8RA 1CLUA 3QUQA 2VRCD 1TYEB 2VQ6A 3BWYA 3R2JA 5TQVA 2VZ8A 4X92A 3MFQA 4FTWA 1N6IA 3P20A 1X70A 1G41A 4M1SA 1OI4A 5KO2A 3AFMA 5BUSA 5L51A 4AZSA 4JP5A 3NTVA 4GL4A 4IIYA 5BMVB 5JJKA 2A7QA 1JW9B 3OFNA 3R5JA 2CDCA 4EJ6A 1ESCA 3WWYA 1VIAA 4OEHA 1MENA 4TQ9A 3USZA 4WAUA 5L53A 4YN3A 5TVKA 4MQBA 1XRRA 1H8HD 4MUKA 3ZNNA 3A9CA 5FV7A 4D9GA 1M7BA 1OB2A 1ULTA 1RTTA 4EG4A 3BFKA 2YVQA 3O31A 1OXTA 3DT8A 3M3HA 2REQB 1X1CA 3GDHA 2QZSA 1UK6A 1MVNA 1Z5UA 4JLOA 2W2MA 4D98A 3LC0A 4RSGA 4ZD6A 2ZVPX 3Q15C 2IDJA 4WE3A 4ER5A 3FYDA 5E3IA 5LB4A 2PZBA 1J2RA 4J0HA 4MHOA 2PX2A 4BNUA 4EGQA 3P2JA 1SQ0A 2ROQA 3ELDA 3O2QB 4OHFA 4DXDA 5AVXA 5I51A 5MF6A 1PR4A 4LQCA 1G64A 1QWSA 2V9ZA 5G53C 4EKEA 1J97A 1QHEA 3IIIA 4DQKA 5JJCA 4AICA 4KXWA 5DTIA 2RHCA 4RJTA 2WC1A 1VE6A 4L8GA 1U8AA 3VGJA 2P2CA 2V4UA 2CZQA 3SHTA 1ZUIA 3NIFB 3UG6A 4I1IA 1TD1A 2J9XB 4LTNA 3AOEA 3OX2A 4CV3A 5KOHA 3SJBA 3FMOB 1IBKB 4WNAB 2GO7A 4TV9F 1WVMA 4G8BA 5EJGA 1P4SA 1QQTA 2YJNA 2GO1A 2P4HX 3IP3A 3FGNA 4KB5A 4CMGA 1EK2A 1X74A 2WLTA 3FSRA 3MQFA 4NABA 3JQRA 4REMA 2XMQA 5FEMA 2B99A 3U6KA 5E7JA 3W7VA 3K8YA 3PICA 3FBWA 1EFPA 5A4AA 1DC3A 5J2UA 1PL7A 3EVTA 2REBA 3TMYA 5LP6F 1SBZA 2IZ1A 3Q7PA 3SC6A 2EVWX 1R66A 2ZR7A 1QE0A 3ANYB 4MPPA 4QUDA 2AMLA 3EZ9A 4XGQA 3GHHA 1EFPB 1HNXB 4YAFA 1X94A 1MEJA 1A27A 5JEDA 4HAYA 4BE9A 4GX2A 1P81A 3KAQA 4XYEA 4PZCA 4YI5A 3CRNA 3SZOA 3O47A 1RIIA 2MHCA 4MUAA 4MWDA 1OROA 4HRVA 4NDZA 4Y67A 1RI5A 4AJKA 1RLTA 2WB4A 1HE2A 2OFXA 1BS9A 4LZPA 1U2ZA 4TX1A 1VECA 4A8TA 5BMVF 5BV0A 4DUZB 4NARA 2F43B 1TK9A 5JD3A 4F9TA 3AHFA 2QSJA 1RZUA 3U4HA 3TR5A 1XTZA 4QFMA 5TGZA 3PC4A 3WTCA 1NY5A 5JU6A 1T5OA 1DEXA 1HMPA 1DTWB 4U2CA 2GVDC 1N1GA 2P4SA 3D6TB 2FETA 3PUYA 4M4SA 4DLUA 4N0EA 4TSKA 4UQPA 1IAQA 5HJ2A 3SEQA 5CYOA 4BWGA 2RFLA 2Y1OA 5FTMA 1ZSVA 3W8EA 1CHNA 5BSTA 3TXYA 1PGNA 1E79D 2WZBA 2ZI6A 3OHPA 4D9KA 1BJTA 4GICA 4H7HA 4YAGA 3L7CA 3A1CA 4C21A 2H4YA 3B6ZA 3LC2O 3BHMA 1YU9A 3MUOA 3OCJA 4RA6B 5CGZA 4CF6A 3L8YA 3E2MA 1P7YA 5CDSA 1IN6A 2JI4A 1R0XA 3AEUB 1NFRA 1E4YA 5FBLB 1J2YA 2QRJA 1G0OA 3KJGA 1EVIA 3BHNA 4J49A 4B2IA 4ZZIA 4J7XA 5KWIA 2BMEA 3KLMX 1KBOA 2IUYA 3OIDA 5EJFA 4ZYLA 1YIAA 4JP1A 3WLSA 2QTVA 1T9GS 2QNRA 3ZYZA 1NKVA 4R0NA 3D7KA 3C7TA 3GLRA 4DMCA 2R97A 5M34A 4IGEA 3V48A 1P3Y1 3EB9A 2AI1A 3WRXA 1UINA 2JFXA 4FFMA 2W2KB 1BYIA 1GQYA 3P8ZA 3TLGB 1WEHA 3CPEA 2IYSA 1KOLA 1Z12A 3I0ZA 3PUKA 2JKZA 4TTPA 4CL8A 3PHJA 3ZE7A 5EJ4A 1NM5C 1DG3A 3R09A 3WISA 4EF5A 3P9QA 3TI9A 5JJIA 4UPEA 1EPUA 1GGNA 4L08A 3C70A 3CR7A 1MQSA 3LXUX 5LLSA 3LXXA 5KDLA 2FE4A 1AQYA 5IHXA 2NTJA 2WYHA 3GT3A 1H1LA 1I6KA 3QGMA 2OEPA 2YS6A 5A0FA 3PNBA 2UZ1B 3LUDA 3TQSA 4XE5A 1T5BA 1L5VA 3OZEA 1TD9A 3VZBA 1WAMA 13PKA 2Y9PB 3EIUA 5KWVA 3LHDA 2W2NA 2R9VA 5DU2A 2WVAA 1WS6A 2YCBA 3UGQA 4B3RB 2BFMA 2I67A 4I5FA 2XYGA 4UVHA 4N5IX 4DF3A 3MWDA 4US0R 3MPOA 1RZRD 3HM9A 3WGJA 4UHJA 1DC8A 3ZWNA 3Q98A 4IMRA 2O57A 4PPYA 5IDXA 1OASA 4I1SA 3THYA 3I76A 3QVOA 1EEHA 3PXGA 1X38A 4M9QA 3I0NA 4YO8A 1JBKA 1JUDA 2OXTA 2YTZA 1YGYA 4URZR 1MAHA 3NT2A 1RNLA 1SXJB 2B4YA 3CMCO 3JD0A 2ZJAA 4AZ3B 1NF2A 3EF1A 3AC0A 4FUTA 3W5CA 2DUMA 2WFZA 1F8FA 4TMWA 4TMZA 1BE1A 1ORTA 3MB5A 4MSUA 4XAQA 5M04A 2WKRA 2RB4A 2BLLA 4OBBA 2AKAB 3C1UA 4DR6B 5ECDA 3QKUA 3ED1A 2G08A 1F8XA 4MEJA 4MOWA 3U1BA 1JWAB 3E5HA 1N5IA 1OZ0A 2H85A 5CJJA 3DQZA 1HSOA 1QIJA 4ER6A 3LMKA 5IK2D 3UMJA 2P2LA 3K32A 3NALA 4BLTA 2O8CA 1IM2A 1C9JA 3GJ8A 3GC6A 3REQA 1CVLA 3Q88A 4NTZA 1CY0A 1XKTA 3KTAA 2M1ZA 5IH7A 3BVPA 1Z2PX 2UKDA 2BGIA 2ZJ4A 4IIUA 5DWDA 2E55A 2QZ9A 1WULS 4X9XA 5J59A 4CEIB 3D6UA 4W9MC 4IL5A 2IY9A 2BZGA 4ZARA 2AOWA 3GFOA 2QENA 4RK4A 1IUNA 3R3JA 2QG4A 1KEVA 4F45A 4O08A 4OK5A 1HDOA 1TM3E 2HPHA 2RHDA 3N70A 1QR2A 5ALEA 5IM4A 1U8CB 2DAPA 4DM4A 4MDHA 1H9CA 5KCZA 1FSPA 1QGED 1KJJA 1EDOA 4I36A 2IOHA 1NF9A 1NRIA 1EXNA 3R1IA 1XBTA 5LOVA 3JQ8A 3TGLA 1TJNA 2XUHA 2SKCA 4M0EA 2UUOA 3VV3A 1IHUA 1NU6A 1A0OA 1CS0B 2GFIA 3VNSA 3KXLA 2HEIA 5DLQC 3G68A 5B57C 3GGSA 1MOPA 5JI3E 4TRNA 4E07A 4EMBA 4LYEA 4P54A 1WXWA 5DHFA 5IASA 5A3RA 1CUGA 1L4BA 1P1IA 3RAFC 1O2DA 1A5SB 5BSVA 1SD5A 2V4ZA 2VK1A 3D3KA 3LCMA 3MS4A 2O2EA 1XEXA 4K7JA 4H31A 3SEAA 4DUGA 1U02A 5CG2A 2XOEA 2DC1A 5EEGA 3WYGA 3GRVA 4MVJP 3DXYA 2ZDHA 4UHEA 4QGBA 1NXOA 4LC9A 4ZYXA 4V0NA 4RTOA 4DBVO 3ZZTA 1C29B 1E7YA 4KLAA 3W1WA 4E5YA 2P5SA 3MCTA 1UDBA 5IF9A 1X87A 2CMDA 3KBBA 2BUAA 5E9QA 3ZC3A 3I05A 1XK6A 2XKAA 2QWXA 4A0GA 1Z38A 3O4HA 4FGKA 2DBVO 4XDZA 4EB0A 1Y9ZA 1Z2NX 1T0HB 3I34X 1WMBA 3KHUA 2O3UA 4PFKA 5CTAA 2GDZA 4XOUA 1TO2E 3IEXA 2OAQ1 6YASA 1XQXA 2EZ9A 3Q7RA 3G2KA 4LZOA 3VKHA 2Z6UA 4TKVA 1G7CA 1GFWA 5DIFA 1LX6A 1RXYA 2FPLA 3L5OA 5KDDA 2JL1A 4E6PA 3C3YA 5TEVA 4OQNA 3KYCB 5DTMA 1E3LA 2CHGA 4AY6A 2RHBA 3D6HA 1XZBA 3C1OA 4AMVA 1YQQA 4GPAA 3BMNA 4J1TA 2PD6A 3NNDA 2MDTA 5CBKA 3PZBA 1AMUA 3MPUA 1RT9A 2XKJE 4IBOA 1L5OA 1NY6A 4V0LA 1XZMA 2OGZA 3FZEA 4XWTA 3RS9A 4EJFA 4ZCTA 2R65A 2JLVA 2A0YA 3GQVA 2XJ4A 3HL0A 3VPHA 1ZGBA 1R0CA 2OZEA 3CR8A 1F9EA 1VE7A 5E4YA 4LX8A 2WYIA 3HJGA 4XKJA 3RT7A 2HB6A 3AIIA 3CCBA 3KDPA 4C30A 3IMKA 3W6PA 1KZYC 2ZB8A 3S8MA 1GV1A 1YRWA 4IKEA 1MTZA 4XW2A 2XUGA 3UFBA 1KQOA 3V1UA 2ZYGA 1KIAA 1V41E 3N8HA 5ENZA 5AUOB 2PL1A 2IH5A 3H6HA 1CYDA 3CEJA 3IBTA 3K6KA 3MJTA 4Q01A 2A0WA 3BJZA 3PKJA 1SIWA 4ZTUB 1SEPA 2N1MA 3JD4A 3AHGA 3ESXA 5B12A 2QAGA 5REQA 1IBRA 2XAUA 5L4SA 3TRDA 1ORDA 2CSUA 4FZ5A 1R4NA 3HLTA 3AT1A 3P4YA 4NX2A 1T0PA 3V1LA 1O8BA 1G18A 2H0AA 3L0YA 3ROPA 3X2SA 5CB8A 4YMSA 5DM2A 2PYDA 5THKA 2YS7A 3RU3A 4F21A 1BVHA 2AW3A 1IJEA 2GS9A 1T8PA 1KYYA 3EVDA 4QL3A 3R76A 1T3ZA 2EG5A 3M4JA 3WIBA 3ZEAA 5E7MA 2X77A 4EO9A 8LDHA 3EG9B 5K1ZA 4D99A 3WGVA 2MOKA 3BEOA 2K7FA 1R18A 2OFOA 1Z5VA 1Z6TA 4FYMA 5LIRA 4LCBA 3C7KA 1ULUA 3R9XA 5B53A 1BO6A 1BQ4A 1ZN2A 5HIIA 1SO8A 1NWHA 2VYND 1EUCB 4DG5A 1UKEA 5KTNA 1LY1A 4DGSA 1PW5A 5LIPA 1IY2A 2WU4A 4IHQA 4DSOA 1X7WA 1KYWA 4Q7EA 4BNXA 3UOWA 2PUJA 5CCEA 1ZRSA 1PEKE 1ZIDA 4CTKA 3PIDA 1VIMA 5KMGB 1MB0A 3PQ6A 1T34A 1IBSA 1XDBA 3CTMA 2ORVA 2X6RA 4J9VA 1TTQB 2JLZA 2XCOA 3STVA 3D3JA 3ONNA 3A6ZA 3OU2A 1QCZA 1J9GA 1J1UA 1ZGAA 1FFWA 1RYNA 4BFTA 1NT4A 2XDQB 3HA3A 3QKWA 1JIQA 1NJ5A 4GEKA 2P2YA 1JXQA 1B8VA 2QN1A 4HNAB 3LP6A 4F3KA 4Q1CA 5LA6B 2ST1A 4KQMA 3TSYA 3IAHA 2F4NA 4GHWA 2DFTA 3D2CA 2BHTA 3TMKA 5DBHX 2W6CX 4KPGA 3HKBB 5DM0A 1YB2A 2CVFA 4IDOA 4ZVNA 3TOXA 5B55A 1IHPA 1MB9A 1KJZA 3AM3A 3CSSA 3P2MA 1ZK4A 4EVIA 3RI3A 3K9WA 4UNIA 1YS9A 2LBPA 4N6OA 3DOOA 4LKOA 3MMXA 4LF7B 2RI6A 1WV1A 4HB0A 3HCEA 2DQZA 2PZGA 5KI6A 3HRHA 1FEZA 3N0RA 1GPAA 3ZZ1A 1M1ZA 1PGOA 2BCEA 4G89A 2QN3A 1SKYB 4LY6A 1T2DA 3ZIDA 1J9ZA 4ESOA 1LPMA 5MDHA 3BQ9A 1TYCA 3BJIC 2CKDA 4B32A 1LW7A 3NUGA 3UF0A 4FMBB 1W5FA 4IMIB 4WKNA 2WNIA 5KWJA 1K75A 2HRBA 1Z08A 1VKNA 1ZM2A 3OESA 2FR8A 4I4CA 1RQXA 2ODQA 2ZUBA 4V03A 3REOA 3FFXA 3EXFA 4L4UA 3SY8A 3V7YA 3PNYA 3TAHA 5M3BA 2PTGA 2C96A 3CJTA 4F7DA 2VUTA 4DTCA 5KTSA 1WPGA 2XH8A 5EGSA 3CYFA 1UANA 2RGXA 3P1JA 3OM1A 4BO2A 1Z6ZA 3MTJA 4GBED 3ZTTA 4Z51A 4KFSA 5I7VA 3DE5X 3O3OB 2GF0A 1O97C 2VF5X 1AGYA 3FKSD 3G2IA 5HCUA 3STYA 2GK7A 3WLMA 4DV2B 4WNCA 1CUFA 1ISSA 1U0JA 1R4AA 1YFZA 3A3NA 3MJVA 3O8QB 3TTSA 3GLFB 2WV9A 1K5HA 2JHPA 4IFIA 4IO1A 1O7JA 2PSSA 2ZBVA 1GD1O 3CW8X 4I8IA 4Q34A 3R4VA 1VC2A 2AG0A 4CT4B 4QYIB 4TXNA 1XMSA 3DP7A 4N9WA 3ACCA 2QAGB 4EL5A 3Q5GA 3I8SA 3LQ1A 3FDJA 3G1UA 1FP6A 2PKEA 4K6GA 4Z0PA 1P60A 2P3SA 2F3RA 3EC7A 5KVVA 3GROA 3SLRA 3GOHA 3AVWA 2HMTA 3GJZA 4G0XA 2AJDA 1DAFA 5DNVA 5KYUA 3K0EA 5FOWA 3QFRA 4X41A 1RPAA 4KQEA 3VKWA 3X1XA 4F72A 1CQZA 3CXRA 5HWSA 3FOWA 5LMUB 2FSHA 1N8TA 1PFQA 4N39A 4PTYA 5D6NA 3C97A 1G6Q1 1HZZC 4Y2UA 1M2GA 2LKCA 3M4ZA 4P7BA 3V3TA 4C0XA 2UUBB 4AJIA 4PBSA 4WEOA 5DHRA 3KU1A 3KYJB 4GGMX 3SZ3A 2ZJZA 1QH8B 1ZUWA 3WGLA 3SD7A 2XB6A 2DEUA 4BKRA 5CFLA 4MV8A 2V6MA 4R05A 3LYUA 4V1CA 4DZZA 2M32A 3KQVA 2A5GA 4G23A 5AW0A 2QRVB 1IQUA 1K7XB 1DHTA 4PHHA 1POXA 3D1VA 5ALFA 3FFTA 1WBJB 3T35A 1PR3A 3KJIA 1MJ5A 1BHJA 2BDEA 1YZKA 3RRFA 2VDRB 2XDQA 2GWRA 5LQMA 4PZDA 2QIPA 4F2DA 1N9ZA 2VPYA 2QUKA 4FDTA 1RLUA 3DOUA 3FFAA 5FLKA 1YDHA 1N4AA 1TRKA 3EOBI 2L19A 3NRJA 3PVZA 3CZCA 2IDMA 4JWTA 4DJDC 4D9NA 4GRAA 1P2BA 1VJCA 1GILA 4MDFA 1PU2A 1NW4A 2PV0A 5JRDS 4CKEB 4B9AA 1YWGO 2HQOA 4ZU3A 3BICA 3X1DA 3N8IA 3WAKA 4BC1A 1NL3A 5IT0A 1DQNA 3HWRA 1TYDE 1XLWA 4JJAA 3FOZA 1J1IA 2IEZA 2NN3C 3CO5A 2YHSA 4EEZA 4R69A 3H42B 4KSYA 1QB8A 1WHSB 2VJLA 4ZALA 5ULLA 2R47A 1OT3A 3HDGA 1HKUA 4WLFA 3ZWDA 3UAYA 4BMSA 3T61A 4BNVA 3PR2B 5ALOA 5GZ6A 1FFXB 4U9IS 2DX7A 4BNGA 1GUYA 4MGZR 1NI4B 3B2EA 4I9UA 4QUBA 1XC7A 3UUGA 1A8HA 1KI1A 1ZGJA 2X2OA 4Q48A 3BGOS 1N2HA 1CUHA 3HJNA 3ORQA 1HTTA 2GT1A 3T9BA 2C4MA 4R1QA 4CN8A 2I3BA 4X93A 2AS0A 2D54A 4E51A 1AY0A 3CLSC 3QLEA 4KPYA 4GOOD 3KTOA 1NLYA 4IKPA 4DJJA 3RS2A 3IKVA 3VPDA 1J7KA 3PXAA 2R00C 3EQ6A 1RVDA 3GT0A 1K9SA 3WICA 2IYWA 3JQ6A 4B82A 1ECGA 3HV0A 3WZ2A 4M89A 3VM6A 2AVNA 1VP3A 2F1KA 7REQB 4RJ2A 3VJMA 3G0DA 4HRXA 2O8DB 1NAHA 1TECE 3IYLW 1NP7A 2DJIA 4GPZA 1GKLA 3H4MA 3L1JA 4H18A 4LSZA 1QO9A 3A14A 4B46A 4TZ6A 3R9XB 5U4XA 1AKVA 3A1DA 3CNQS 2CL7X 4MS1A 4PXAA 3IP9A 5D3MB 2P0EA 3A3KA 3LCUA 4QQFA 3EIQA 1P7VA 1O1YA 3QG5A 2JJ1A 3F5FA 3NIWA 2C4UA 4RESA 5BYAA 4MP6A 3IAAA 1BOFA 4L7VA 3A11A 2EZUA 4QBTA 3HGQA 1ZXBA 2NPIA 1VSVA 5TS2A 1T15A 2OAP1 1A72A 4CKXA 4F38A 2OA0A 1OY1A 1O9HA 1T6XA 3TS1A 3WWDA 4ALJA 1PL8A 1J70A 4D9BA 5LSAA 2AH5A 2WIKA 5EWLA 2NUPB 1D9XA 1ZNZA 2A1IA 2INGX 2Y1LA 4KQXA 3T3PB 4E6EA 5EOVA 1ORRA 1GZ7A 5EVCA 4QUGA 3I30X 3KTAB 1H2FA 1NG1A 4HDMB 3UHFA 3I5AA 3NCHA 3LLMA 3L77A 5JNVA 4AS1A 1VJ1A 5BUCA 3P2YA 4ENVA 5G1OA 3I5YA 5T3YA 1JHDA 4EG0A 1NJ1A 4QDKA 1CIJA 5EQFA 1ZD8A 2B7LA 1U11A 3P4UA 4AS3A 5AJZA 1DIAA 2QR5A 5AW8A 1LLCA 1L7BA 1R0SA 4DBLC 2QLBA 2C29D 3FDZA 2GXAA 4TLBA 2XB9A 3EDRA 2OESA 4ZT7A 2CNDA 1G8AA 3S40A 4CFYA 3S8EA 1E64A 1SR8A 2NO0A 5DN6D 4NDNE 4B75A 4YCBA 1TZBA 1Z0JA 4QU5A 5FWAA 1UK7A 2J0VA 1ID1A 3QFFA 4Q19A 3R3ZA 3SJUA 2QRLA 1KI6A 1OLUB 4G3XA 3LTNC 2VF2A 3AR7A 5FPQA 3D0KA 1JT9A 1NV8A 4QJ3A 2HWUA 2I0FA 1UBUS 2V9CA 4XUEA 3NIGB 4AB1A 3WLJA 2AFHE 2ERCA 3CPSA 3FVWA 4F84A 1U9CA 2EGHA 2EKBA 2I2BA 3RUHA 2FEWB 5KREA 3UWMA 2DLCX 4Z4EA 3PTLA 1E1MA 2ZAYA 4V0SA 2IUFA 3C3DA 1IXKA 2C2OA 1SGWA 2Y6VA 5KQLA 1RAIA 3UM9A 1S96A 4IY1A 5LQJA 1LK7A 3FUCA 4KBFA 1RYDA 1IL0A 4PYLA 3UV3A 3ENKA 4AU1A 3HCWA 1E5XA 1E1DA 4LPKA 3RRJA 1J2UA 5KDOA 4N40A 4GVPA 1UXIA 5L4NA 1X1DA 1T3SA 4U5QA 1HDZA 5A9TA 2FEPA 4IX1A 1DO0A 1F3OA 1JIIA 3VUEA 4XM0A 3VNUA 2AOXA 5ARDA 2JA2A 4OHPA 1I7SB 1E9EA 1CP3A 1ZN7A 3JASA 3IP6A 2AX3A 1Y4SA 1JWBB 3AUYA 5B1DA 1X7YA 1JPNA 4UUAA 1L0BA 2H2DA 3IJPA 1FB5A 2LXNA 2W2QA 1NWCA 1CQJA 1JEDA 2BMWA 3N0VA 4TZKA 4ARZB 4ATNA 5EHGA 2BVNA 1NVWQ 3ZDCA 4HVTA 5AMXA 2AZMA 2HCRA 4YRJA 4PTZA 5FUBA 3WB9A 2VPZA 3O94A 3B3AA 3FWPA 3GJYA 1LUAA 3W5UA 2VXYA 4PHFA 5FR1A 5JIBA 4CHGA 5GV8A 1UKBA 4QEDA 4QOSA 1I5RA 1KBZA 2PX4A 3M6XA 2P2DA 4G8JA 4H4CA 3VDRA 2PT7A 3OCVA 4H6WA 3ZY6A 1USKA 2Y8EA 4DQUA 5HS4A 1PK7A 2IZ5A 4RELA 4LXXA 2OCLA 2YUIA 3L0DA 4MX8A 4AN4A 1E2IA 4E09A 4GZMA 1AF4A 3FLBA 4J03A 3BGIA 4MCJA 4D9EA 1UEXC 1ZEMA 2OCIA 3MS7A 5H68A 3UGTA 5LKRA 3SC2A 4JI0B 1X7XA 3NHKA 5D5HA 5K3SA 2NV0A 2QP4A 3CMMA 5F98A 1EFRD 2WTXA 4MLZA 1REQB 4NG5A 5TLSA 2ONZA 1S02A 3ONVA 1US8B 2Q2OA 1KVUA 1G66A 2H5EA 3ESYA 3NYWA 1B1CA 2NU9B 4DLRA 4RSHA 1U9ZA 1R64A 5TJHA 5EWLB 1KORA 3BF7A 1VLQA 3RWBA 4WN9A 3VH3A 1NBMA 2D59A 1EWTA 2J4FA 2Z8YM 3JVUA 1P6UA 3RBAA 1VB3A 1FNDA 2FLVA 2BTEA 2B83A 4JJ4A 3OEWA 2C2XA 4HG2A 2NAFA 3NRCA 3R7LA 4B6QA 3KE8A 1VHWA 2OGUA 2R8YA 3A37A 3KYIB 4RTKA 1H1LB 4D9JA 2D6FA 1M8PA 4GKVA 1Z7EA 1Z6YA 3S68A 2CL6X 1FU8A 4XIIA 4AN0A 4WK2B 4H0NA 3R3YA 5JH7A 1OREA 3TCKA 2P40A 3EGEA 4ZAFA 3R3XA 3NOQA 4DA0A 1GU7A 2JK1A 5HIJA 3L0IB 4OHYA 3HUTA 1MU0A 4Q12A 3HB9A 4PX2A 1SB9A 1Y7PA 4AL4A 2DP4E 2MYTA 1SY7A 1SC9A 1T24A 4A7PA 2B0JA 4FEEA 1MOZA 1W0JD 1O58A 2WTAA 3N3BC 4LZAA 2J08A 3PC8C 4CV2A 1ZM9A 2PX5A 2VYCA 4HJRA 4QPZA 4UD6A 4ZV4A 5GINE 1LSOA 1GUFA 5CA0A 3TKLA 3B8HA 2CXQA 3OTWA 4H3VA 4HR7A 4EELA 1WXFA 5I7AA 3ZWWA 4ER0A 1CF4A 5CLLA 3LUFA 3RS4A 4RTLA 4HBGA 5MGNA 2PKWA 2Y92A 4JJKA 4AM8A 1KL7A 2C2WA 2D00A 2LE0A 4YRPA 5C7IO 2WJJA 4UKDA 1V5FA 4WZBB 2Q6OA 1RXWA 2FWMX 2XGMA 3AUUA 3O7WA 3OHMA 5TSDA 3S55A 4WFJA 3TZEA 5KNCA 1AHPA 3SR3A 3CNHA 1FJGB 1BTOA 3PKZA 2JC3A 2NXJA 4HSGA 4HYEA 4P80A 4PRZA 1R4MB 3PLAE 3JQPA 4O2AF 4GVXA 4A8PA 3UBTA 2OP0A 2RGRA 4K0KB 1JLHA 3WYBA 2GH1A 3O83A 2O23A 1DAGA 4Q93A 1EWRA 1OFIA 5A1TA 5I7HA 2HU5A 3IKMB 3V9AA 4J0JA 4NI5A 4BVKA 4IF6A 2GZRA 3RRMA 1JS1X 3O26A 3CPJB 3GJ5A 4RKQA 2ERXA 3SS7X 1SVOA 3LRPA 4RK5A 3VMFA 2A0XA 4FWTA 4CQMB 3X44A 5I4IA 2Y3IA 1F17A 3E15A 2B6HA 2WIFA 5EIAA 3P96A 5HTKA 4UC0A 2PUFA 2QHXA 1E2MA 1SCDA 3HMQA 1XTVA 3WNBA 3V7WA 4CT0A 1QF7A 2ZE6A 2WTUA 2IBSA 4G65A 4MKXA 1NHGA 2GCIA 4HXFB 5TPZA 5KYVA 4XYLA 3THWB 1TRHA 4MHTA 2QRQA 4KGZA 3KLPX 1L8QA 5DX0A 3RVQA 3WGHA 4JDUA 5ALLA 2IYXA 3EEFA 2A6PA 2JGFA 3PUIA 1PNOA 3FPGA 4O0LA 4YCCA 1Y5NA 3QU5A 2CVPA 2GUWA 4PS1A 1QB7A 2VUUA 4TN5A 4XX0A 3KSAC 2P2GA 4HH0A 1QBGA 2Z09A 3A1UA 4OYHA 3G8DA 1SCUA 4LCEA 3BIOA 1JEQB 3BMCB 4RCVA 2G40A 1T0JB 5H02A 3KNZA 4WGGA 2GF2A 4YGYA 1JDZA 4OL9A 3LBHA 5CEJA 4HWRA 2BE7A 1PEDA 4JCCA 2QL5A 1U4OA 3DBLA 5FI0B 4HD8A 3DHNA 2R44A 2FQYA 3ZVNA 5IZCC 2IIQA 5C8ZA 3GXBA 3OEED 1QH1B 2G17A 2BUBA 3FPEA 1GQOA 3IX7A 2ZQYA 4HLDA 5JWOA 3BERA 4CKCB 1N7JA 1DCKA 4DCTA 1JE0A 1XGKA 5I9MA 3ZQ4A 3P5SA 1OX4B 1V3TA 3A9UA 4OLHA 2F3TA 3EZ6A 2CHFA 4A2WA 4B4VA 3SFZA 4TYNA 1THZA 2CD9A 1CFJA 4BQNA 4UOEA 5CD1A 4OLJA 1W49A 3FCSB 4D97A 3S5JA 5JNTA 1WPRA 1YMUA 4O2AA 3W6OA 4RH3A 4J16C 3U60B 4Q3OA 1G6OA 2JKVA 1VYTA 2Z30A 2NVUB 3EGXB 2VOEA 1DT3A 2QKYA 1Z22A 2M1XA 3CVYA 3S44A 3STHA 4PBTA 4Z4FA 4EARA 3VR5H 3KKOA 3EA4A 3VGPA 3OOHA 1XAIA 2ZDGA 4Z4IA 2IQIA 4A92A 4IDFA 5KNCD 2ZRQA 3TCNA 1CIPA 2OM2A 1BEEA 2QVYX 4QOIA 3HBJA 3G79A 5SICE 3EEBA 4FHDA 4P3OA 1TIBA 2W9XA 5CIWA 4XH9B 3PFCA 4OJTA 4XTRA 5FQOA 3CRW1 3DKVA 3AMVA 1CCWA 1EB9A 1M34E 2RJOA 2XZPA 3UMMA 1JSXA 2GI4A 3GA7A 2MSWA 4AKTA 5BW8A 1I80A 2XCQA 4KO1S 4M3NA 2YN0A 4C76A 3AZPA 5CH8A 3TUIC 4Q4HB 2IZ6A 4LRWA 2C1XA 2G5GX 3DBHA 3IRUA 3EZ7A 4TM7A 3IOCA 1FDRA 2N46A 4X7PA 4B3TB 2DRIA 2Q5FA 4PYMA 3W1EA 1O89A 3AERA 1C4XA 3W5VA 3Q85A 2IQ5A 3M70A 5E9WA 5EEHA 1RWVA 4Y18A 1VYUA 3ROMA 4AY4A 3U7QB 4RE5A 4NXMB 4WBNB 4DA8A 2R66A 3A8TA 1BA2A 3DTVA 3IAEA 3LWNA 2PMWB 1PKXA 4HNHA 1S2MA 1DKRA 1YTLA 2IZ0A 3ZBPA 4CIXA 2ON6A 4POOA 4PHCA 1T1SA 2GYWA 3KWFA 5KC9A 3DFIA 3NHFA 4ZVRA 2W37A 1NP6A 3JYHA 3NEYA 3VPSA 4WBNA 1ISGA 1J33A 2K2QB 4FNGA 3FCOA 4W7SA 2QN9A 4JLJA 3U37A 3QFHA 2R1UA 4RKFA 3VNQA 4MWBA 7GPBA 1QP0A 4Y2GA 1ZNQO 1ACMA 4JC4A 4L7QA 3KEMA 2HA7A 1MUUA 1UM9B 2EDAA 1N6KA 1P6XA 2CLMB 1I33A 5DI9A 3RLFA 4UHBA 4D4IA 4OBWA 2DHRA 1YDEA 1Z39A 3B1FA 1ZSYA 3TF5A 2ZM6B 4WWHA 3HADA 1UXJA 4AROA 4QM6A 5IVDA 5K3FA 2GKSA 4WCDA 1Q15A 3UAGA 5FLEX 3HMKA 2QGNA 4NECA 4GWLA 1PUXA 3E9DA 2ZWPA 1WXEA 1JSLA 4OAPA 4YB8A 5FPHA 3VR0A 3ESRA 3G23A 5HM6A 1KMQA 2E4VA 1RM3A 1SRRA 5K8IA 3KSMA 1AE1A 1C80A 1PWXA