6CHYA

Structure of chemotaxis protein chey
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of CheY mutants Y106W and T87I/Y106W. CheY activation correlates with movement of residue 106.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Signal transduction protein
molecule keywords CHEY
total genus 46
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6chyA00
4Z4HA 1ABEA 1U2PA 3HS3A 3CKMA 1JYEA 3LKVA 4OTZA 1Z12A 3TO5A 3K9CA 4HNRA 1K66A 2NT4A 3M9XA 1FSPA 2JBAB 2VK2A 2PL9A 5F64A 4D74A 3ILHA 1EFAA 3JTEA 3RVJA 4KQCA 3F7NA 3SNKA 3IPCA 1DCKA 4L4UA 3E61A 1GCAA 3UK0A 3VNAA 5T7BA 3HK2A 5TQJA 2IOYA 1ZGGA 3LUGA 4MRMA 5CNIA 2QVGA 4NCAA 2LP4Y 3FDFA 1W9HA 4EYOA 4IMJB 1PNTA 2I6FA 5IEJA 1P2FA 3A0RB 3O74A 4EYKA 5FWYA 4MRMB 2A9RA 1JFSA 1NTRA 1M5TA 3KLNA 4KREA 2GBPA 4MS4B 5TE9A 4GPAA 2MYPA 3JPYA 4MQEA 4RKQA 1ABFA 3MMNA 3JY6A 3OLWA 2GX6A 3QK7A 5JNWA 3DLHA 1E2BA 1DJMA 4L85A 4TLLB 2NT3A 1VRVA 1PUXA 2JBAA 3QEMB 3MM4A 3QLVA 1LK0A 3I09A 2YHBA 3KYIB 4W5OA 2N9UA 3H5VA 4Z4CA 4OATA 2ZWMA 2L18A 1FFGA 4XARA 3OQMA 1CYEA 1Z26A 2PMCA 3KYJB 4W5RA 1TLFA 2CHFA 1URPA 3R0JA 3NNDA 2PLNA 2PUBA 2X7XA 2A9OA 1E6MA 1YIOA 3KLOA 3LUAA 1MB3A 4RWEA 5I4CA 4OLBA 2GI4A 1ZY2A 1A04A 2IPAB 3C3KA 5FBHA 4W5TA 3CRNA 4Y9TA 4IGAA 3QLUC 4WXMA 3N53A 3G85A 2IPMA 1ZH4A 3OMWA 1JHZA 3F6PA 2R4QA 5TQ2A 1GCGA 4MR8B 3QX8A 5EWLA 3F6CA 3KG2A 1Z15A 4XAQA 1ZAYA 3BRQA 1DCMA 1YVUA 3HVRA 4RY8A 1NY5A 2M1ZA 4MS4A 1JWLA 1ZDMA 1XHFA 1RPJA 3BREA 3GBVA 3RQIA 3TB6A 4LE0A 1IIBA 5IBQA 1AB5A 3T38A 4DQDA 3H1FA 2R48A 4ZPJA 5DLEA 3C3WA 3DLBA 4MLCA 4Q6WA 3IP6A 2QV0A 3EAFA 1A2OA 1F4VA 2ID7A 3GBPA 3NHMA 1EHCA 3FFWA 4XFKA 3RVKA 1QMPA 5KQGA 2LUOA 3OO1A 4O1IA 4KMRA 4YS6A 4EYQA 4S05A 1NXTA 4KPYA 3OLZA 1Z25A 3KS9A 2PUAA 4G0YA 2E4VA 3OQNA 3CZCA 1DC8A 5B3JA 3EGCA 3I5AA 3L49A 4EVRA 1LJLA 2FN9A 4MR9A 2V0NA 4KQ9A 4YP9A 4IILA 1PNRA 4RDCA 3QELB 4RS3A 2WY2D 4RY0A 4ETNA 1RZRA 2RGYA 2FXIA 3H1GA 4KZKA 1DRKA 2FQYA 3H5TA 4Q7EA 3MYYA 4RK6A 9ABPA 1DRJA 1QP7A 2AYXA 2PL1A 4YR7A 5EWJA 5GOTA 4YRZA 4N41A 4ETMA 5TPWA 4TMYA 1ZH2A 2R47A 1PEAA 1FFSA 4IF4A 5KI6A 2PKXA 1LBIA 2IDMA 1Z18A 2FMFA 2FMKA 2ID9A 4YGXB 3SAJA 1VPWA 2MYTA 5JS1A 4WT7A 3JS5A 5E3JA 3TD9A 1C0EA 4PYRA 2IPLA 3URMA 4D6YA 4KNYA 5KQLA 5IC5A 3H1EA 1BDIA 4Z0NA 4EUKA 4Z99A 4ZMSA 4NV3A 5C5CA 5BQ3A 5JNSA 2IKSA 1NATA 3RVNA 1ISSA 1LBHA 4EYGA 4KK3A 1JF8A 2IPNA 1D2AA 3HJFA 4MQEB 4E7OA 1D5WA 4N0PA 2F8TA 4Q6BA 3JPWA 4JOQA 5EWMA 3LUJA 3D02A 3C6QA 2FVYA 2RJOA 3HUUA 5PNTA 1OXBB 3GT7A 4MQFA 3A3KA 2QVCA 3Q7TA 1NXSA 2L17A 1DG9A 2LBPA 2FLKA 3CG4A 3NBMA 2HPHA 1PHRA 4ZMRA 2BGGA 4O5AA 2E4YA 4H60A 1YK1A 3RVOA 2FMHA 4PE5B 3P9YA 4ETIA 5HQJA 1T34A 3FGZA 4Z9AA 2WWVD 3C3MA 4EY3A 1Z2DA 1USKA 3RVLA 2HQOA 3RVRA 5ABPA 3I42A 3RH0A 3JVIA 4D6XA 1SXGA 4QYWA 5C5EA 2FMIA 2H0AA 4IMIB 2W42A 2NUBA 2FTKE 4PICA 5HM6A 4W5QA 4OG2A 4DADA 3EDCA 2J48A 1U0SY 2H3HA 6CHYA 3LKBA 4RY9A 1P6UA 5GQSA 2B4AA 4RK1A 4WUTA 3ROFA 6ABPA 4QYMA 3HV2A 1L5YA 2CHEA 3QLVC 4M88A 5IUNC 4UHJA 4N47A 7ABPA 3MF4A 3O2QB 3QLUA 4RXUA 3KSMA 3IPAA 1GUDA 2Q5CA 4N03A 5IX8A 1QQBA 2HQBA 4Z4IA 4RK0A 3DBIA 5FWXA 4HNSA 4RXMA 1Z17A 5TPZA 3CFYA 4FE7A 3RVQA 1USIA 3IDOA 1FFWA 3FFXA 3O1JC 3QX9A 5FWXB 2JK1A 2RDMA 3JVDA 4G0XA 5JS2A 3H5IA 1Y1LA 1AB6A 1F51E 2A9QA 3N0WA 5D2CA 2PE5A 1TM2A 1JBEA 1BVHA 1KRXA 3N0XA 2FKAA 4G0OA 3HEBA 4LZLA 4YLEA 2OENG 4EVSA 2NZUG 4LE1A 3GL9A 1NXPA 4E7PA 5KC8A 4LE2A 3SY8A 2LPMA 4MS1B 4MR7B 3LOPA 1C4WA 3GA5A 3EQ2A 3A10A 1QP0A 2QU7A 4UHKA 4IRXA 4ML3A 1EWKA 3GRCA 3DGEC 5DCLA 3EULA 3O1HB 1ZGZA 1A0OA 4MR7A 4FB4A 3EJWA 4FE4A 3S99A 5DTEA 2JVKA 5BRAA 3I45A 3O75A 5BR1A 5KQPA 3UUGA 2WRZA 3T6KA 1JFTA 4G86A 1EWVA 1NXVA 2PUDA 1DC7A 5EWJB 1BA2A 1KGSA 3IP9A 1USGA 4P1ZA 5KQMA 3IP7A 5T3YA 3LUCA 3H75A 4RXTA 1QO0D 3W9SA 4Z9BA 3O21A 5B3JC 3H5OA 4O1HA 4F12A 1YMVA 2YHAA 3IP5A 2PUCA 3QEKA 3LUHA 5HKOA 1WETA 5JNRA 4LX8A 4CBVA 1CHNA 1JX6A 1GUBA 1U2QA 3HCWA 2JCGA 2FEPA 4H3KB 4YWHA 5JNTA 1ZESA 2ZAYA 1QO0A 2QZJA 4KV7A 2JVJA 2RJNA 1RXIA 2FW0A 2HJ9A 4RV5A 4HYEA 3TX6A 1MIHA 1SRRA 4MR9B 1JL3A 4LDAA 1JDPA 4PZ0A 3CTPA 3HDGA 4JB2A 5DKFA 3RVPA 1EAYA 4MPTA 4ZJPA 4DN6A 1SD5A 4Z4EA 3CS3A 1VKRA 3M9WA 3LTEA 4RKRA 1CEYA 2E4XA 1L5ZA 4MLDA 4W5NA 1J56A 1TVMA 4GNRA 3M6MD 3HM9A 1SXIA 3CG0A 4MS3A 2FSPA 5CNKA 1DZ3A 3RVSA 3SM9A 1JDNA 2E4WA 4NICA 2AYZA 3OM0A 3HSYA 1S8NA 4KVFA 5CHYA 2E4UA 1K68A 1P8AA 3SQNA 3GV0A 1EWTA 1YS7A 4PEVA 1DCFA 2FLWA 1PEYA 2P9HA 8ABPA 4S04A 1SXHA 4LRQA 2GWRA 5TQ2B 3BBLA 3N6VA 1MB0A 1ZITA 4RZSA 3O2SB 5IEBA 2JVIA 1MVOA 2P4UA 4G0MA 3N8IA 4JB0A 5JNVA 3KHTA 4NCBA 1BDHA 3OO0A 1QPZA 2CD7A 1FQWA 1GLGA 1VLZA 3FFTA 3Q7RA 3G1WA 4F3TA 1RXEA 4JA2A 2B1JA 3C97A 4JASB 5EWMB 3NNSA 2PAFA 3FMVA 3D8UA 3E3MA 4TN5A 3HZHA 4HNQA 1NXXA 4Z4FA 1JH9A 3KCNA 4WXEA 3B2NA 1KMIY 2PUEA 4YCSA 2PUGA 3NHZA 1BAPA 3KTOA 1XHEA 3KJXA 1B00A 3EQZA 2VUHB 4WZZA 4TLMB 3OM1A 3MQ4A 2QW1A 3QELA 4ZYLA 1QNLA 3QLTA 3GWGA 2FQWA 1M2EA 4H3HB 1NXOA 4G0QA 4JAVC 5IULC 1NXWA 1YS6A 1ZN2A 1TMYA 2NZVG 4G0PA 4LDZA 5HSGA 2QSJA 2QR3A 4WWHA 3LUDA 2MSWA 2HQRA 2IYNA 1RZRD 2OQRA 3HUTA 3VNBA 2MSLA 4MGEA 4YV7A 3K4HA 4RU1A 2JB9A 1D1PA 2QXYA 3MA0A 4YO7A 5IUKC 5TPWB 3T95A 3OMXA 3QEMA 4F06A 3UKJA 5ED4A 1APBA 2L2QA 3O1IC 3HO1A 2HSGA 1U8TA 1OXKB 2FEWB 3LUKA 1DBWA 3HXMA 2GKGA 2DRIA 1QP4A 2WMYA 2XDYA 1TJYA 3N75A 2WB4A 1P6QA 3OQOA 4RSMA 4EVQA 1JLKA 1JYFA 2L19A 3O2JA 3RVMA 3KKEA 5KC9A 4NQRA 5CNJA 3ILYA 4KK4A 3Q15C 1BDJA 4N0QA 1ZHHA 1DBQA 1JFVA 3LFTA 2PUFA 4RK7A 3CU5A 3CHYA 3MIZA 2R25B 3TMYA 5EWLB 4KFCA 5TQ0B 3T8YA 3LMKA 5JNUA 2CWDA 1M5UA 2E4ZA 4MR8A 3CLKA 1W25A 4P98A 4N76A 3HDVA 1I3CA 1ISRA 5KWSA 1D1QA 1H9CA 2MYUA 3H5WA 2WJAA 4G0ZA 4MAAA 4XXHA 1D4ZA 4OBBA 4QPJC 1Z16A 2LIVA 3Q41A 1DBPA 2JRLA 3ROTA 1XWWA 2FN8A 2M98A 2FEKA 4XLTA 3SG0A 1QQAA 1Z2EA 1E6LA 3L6UA 3N0RA 1U04A 2O20A 2VUIB 1LJUA 3A0UA 4G97A 4MYRA 4XASA 5TPZD 5IUJC 1MAVA 1UDRA 2TMYA 3CNBA 1RNLA 3OLYA 2WJWA 4QICA 2PJUA 3CZ5A 4JP1A 3EODA 4KRFA 1E6KA 1KRWA 3Q9SA 2F8SA 3BRSA 1YK0A 2MSKA 3H6HA 1DP4A 3H5LA 5FBKA 5FWYB 3DZDA 1R8JA 2KYRA 2MYNA 1QKKA 4MQFB 4F11A 2FQXA 4RK5A 4OLAA 3BILA 3DGFC 5CNMA 5TQ0A 5BRJA 3GYBA 3OLVA 4B09A 4EGSA 1YMUA 4MS1A 4F8JA 1M2FA 3F73A 3LUFA 3Q7SA 1HEYA 1ZVVA 4Z4GA 1Z13A 4RK4A 5DGCA 1YTUA 3NNNA 2VYCA 3H6GA 2A9PA 4MS3B 3OLXA
chains in the Genus database with same CATH superfamily
4PBTA 5JG7A 5U4QA 3CUWA 4F60A 1HE2A 1TZJA 2CLMB 3TTSA 1E96A 3KAPA 3KZMA 1WDWB 1A4IA 1MC1A 3H8JA 2PEYA 1JIJA 2ZRFA 2VDOB 3N3BC 1FU4A 3OU7A 2A9VA 4TTRA 4B9AA 1R0CA 1W5SA 1SBHA 2IX3A 4BGDA 3ON5A 5FTJA 2Q5FA 1HE1C 1A50B 1QLWA 3TAHA 1XJCA 1ZW1A 1CU1A 3DT6A 2I1VB 2QVGA 2R85A 4A16A 2BFDA 4IGKA 1XPJA 2XGMA 3HABA 2AEEA 5DYGA 4ZDKA 1NI3A 2J0UA 4M3NA 2Z56A 3QPUA 3VA7A 3K1AA 1BCSB 1GNLA 1M5TA 1NTRA 1ZR2A 3G7UA 2BFDB 5UKDA 2LCQA 1DKRA 4JOCA 2VDWB 3QK7A 3PR3A 1E5LA 3ANLA 3B1XA 3G9QA 3OPYI 1N4AA 3DLHA 3QY0A 3I04A 2VSXA 2XYPA 4ICIA 5HFAA 2C3YA 3P97A 4ZQEA 4EI2A 4NV0A 4UZFA 1B8UA 2P6PA 4RORA 1VBFA 1XKXA 2KLBA 2P35A 4FMDF 4INOA 5AJXA 4I4TB 4ZRDA 3V48A 1KAHA 4W82A 1KQGA 4GR9A 1KEEA 1V2GA 4MDHA 2CHFA 4MUMA 4PBSA 1O08A 4U8GA 3KU1A 3RSHA 3V4ZA 2H4HA 2QQGA 4B35A 2G08A 1WEHA 2ONYA 4HHEA 2B2CA 3M4XA 3EXIB 2PSSA 4NYIR 3OM8A 2CK3D 1ZBDA 5G40A 2JS7A 1R8XA 4G5RA 1SCKA 4JI1B 3P4YA 4EGFA 1PLKA 3QUCA 5I4CA 4OLBA 1N5MA 2WD7B 5FPHA 4Q37A 4B3RB 3IELA 4NF2A 1VMAA 1QR6A 3RCBA 1NRIA 5I9IA 1UC9A 3HA3A 1N32B 4WJLA 1K0FA 5KDDA 2IPMA 1YBVA 4PXYA 1XTKA 5HOQA 1HOXA 3OMWA 4BQIA 1HPLA 1W29A 3C1TA 1XQ1A 3CPJB 2OFFA 4YRFA 1OBHA 1POXA 1QV9A 2B37A 2PQ2A 2Y27A 4P34A 4F9FA 2Q1YA 2O8DB 4D82A 3F6CA 3SEQA 5E1OA 2B7BA 5ITWA 1CY1A 4XKJA 5C8YB 5E6UA 2JJ2D 3QVMA 1Z8HA 3B36A 5K0LA 3MWDA 3RQIA 2G76A 4CL0A 2HHJA 2MMCA 5CB4B 3ZW9A 5FORA 3DBRA 5E2AA 2FN4A 4FTWA 3QUBA 3AVTA 1C14A 4AJPA 2JGAA 4F91B 3ZDCA 3RF6A 3L1KA 1AKVA 3LLMA 2ID7A 4BFUA 1IDOA 2YXDA 3IT1A 3WOHA 4HFNA 1E0SA 4DIUA 1UJ4A 2OFWA 4B7AA 4C6TA 5D3KA 4C0KA 2NO1A 3L77A 4L8GA 4Y1FA 3W2HA 3L4KA 3HB5X 4AK9A 3OZVA 2VATA 2XUZA 2OCXA 3W3AH 3KHSA 3FVRA 3ML1A 4U7JA 3VISA 2OZPA 4NYJR 5G0WA 2HCJB 4V3CA 3MOIA 1KMNA 1QHHA 4KQ9A 3VBEA 4Z54A 5FWNA 3PFBA 3BL6A 1U6IA 1MU0A 3FCXA 3SMVA 4UPEA 1V7ZA 4V0QA 2J45A 3HUEA 4UVDA 4Q1BA 1NUUA 3I2FA 2WYOA 2RCYA 3C6ZA 1SCDA 4Q4DA 3GRVA 1V6CA 2QRQA 3JQFA 5LYJB 3GVPA 3LC2O 4QBTA 4XQGA 3F46A 3AHHA 4GICA 1M10A 3USZA 2OY0A 4LF6B 4M86A 1VA5A 5BURA 1KYXA 1C3LA 4L4SA 4I55B 2C5GA 3QPCA 4NV1A 4US2R 5L4SA 3WHPA 1T24A 3EWNA 3IEPA 3HXQA 1ZP6A 4U7WA 1K4YA 1CD5A 4Z1MA 2VO1A 3FYCA 2PWPA 2BFEB 1AQUA 2FLVA 1JILA 3O4VA 5EKTA 3UMVA 2ASEA 1EFDN 1UPCA 2Y1CA 1SFRA 2YBEA 4NS1A 1HYGA 2GKOA 2EQBA 1V7QA 1II8B 2JI6A 1Y1TA 4L5BA 1KQ3A 5A0FA 2QUBA 3ZQKA 3VYSB 3R8FA 2P3SA 5KQLA 1P75A 4M9RA 3KYCB 1QWSA 2OSVA 4LNUA 2YQZA 3WYDA 1J7KA 4OQFA 1E2IA 1KYVA 3OQIB 2C96A 3RVNA 1E1MA 1NATA 1KEUA 5LXTB 5T6MA 1W9MA 2I6QA 4Z3OA 4MWOA 4E7OA 2F8TA 5LLTA 3WK4A 3U39A 4ISCA 2EZ4A 4ID3A 2O0JA 3PQFA 3WGMA 3KJEA 5FTNA 4JI4B 1KXZA 1YS4A 2WU1A 3DL4A 3I2YX 2NU8A 4TKZA 5JH7A 2F3PA 3GT7A 5BNFA 1TMKA 1XEWY 4ZOLB 1H85A 2X6RA 4LCJA 3TLJA 4OHWA 3G23A 4CCSA 1DG9A 4KQWA 5B6PA 1NF8A 1T1SA 2ZJZA 2PZAA 1I0IA 1PGJA 3JVEA 1J5EB 3SS7X 1XV5A 3TTUA 8OHMA 1ZJ6A 1PJLA 1LPPA 3P0EA 2YMLA 4FMPA 4JSRA 3VAYA 4Q1VA 2YY6A 5G4LA 1XTVA 4KGVA 3UV6A 3W3AD 4TYWA 1O96A 3UNXA 2QMHA 2JAOA 4DIKA 4X24A 3PNBA 4LVNA 4P3KA 4AZ0B 3JVIA 5JAPA 2HHCA 3QF4B 4BAZA 1NJ1A 2NV6A 2QN6A 3QX7A 4OK6A 3O4GA 2BDUA 5FFFA 3WZ2A 4BRSA 1I1HA 4BMCA 3GFFA 3U7QB 5CDYA 3L7IA 3EDCA 4FYVA 1LDYA 6CHYA 3T1TA 2OSBA 4U2BA 2IHUA 5AKEA 4DA8A 1NZDA 3GPLA 2IHTA 3GZJA 4RK1A 4A82A 4P0QB 4PO1A 2AD5A 1A69A 1HLFA 1PN3A 5HK8A 4DNXA 2DERA 5J5AA 1J20A 3D5EA 3RYHB 4HVAA 1YL6A 1XYGA 1ZCZA 1F2UB 2FG7C 4MGZR 5CURA 5FHQA 2W90A 3RS8A 5DHRA 3TLAA 5EFZA 1N9GA 5LUAA 3AUTA 5AXBA 4R7TA 1USVA 2ZDHA 3ES9A 1T25A 3W3ZB 5AW0A 2DFKB 1TVEA 1HKUA 3C48A 4NU0A 3K70D 1VYVA 1HTTA 1T5OA 3IB3A 4RJKA 1PD0A 3H9UA 4LOIA 3FVTA 4BLQA 1L4GA 1BMTA 1YOVB 2O07A 1ZD8A 4KN8A 3CFYA 2J1LA 3RVQA 2PY6A 1LFDB 1E0DA 1U2DC 3MB5A 3QX9A 1QRRA 2QWXA 1YVDA 4BQSA 5HIJA 4L28A 3H9JA 4X6YA 2HR1A 1YI0A 4D8VA 4K6OA 5JZOA 1R0ZA 4QUEA 1JBEA 4JT8A 5LZ9A 2YVLA 1E3SA 4LHZA 1FDUA 1BVHA 4P22A 4ZCPA 1ZIOA 1IOLA 1BJKA 1NQAO 2X9VA 2Z30A 4M6WB 3JQ7B 3ZLVA 4ZJYA 1V1JA 4RH3A 5GVSA 5LQKA 1NHGA 1LTHR 3BOSA 3OH8A 3QKUA 5DBEX 4JI8B 1ZRNA 5HQ3B 1IXRC 3LU1A 4DLKA 3AOEC 4LE2A 4DXDA 3IERA 2A0XA 1YZLA 3SY8A 1FSZA 10MHA 1LRLA 1RT9A 2XQVA 1LU9A 4BGEA 4MKIA 1ZMOA 1X1SA 5CU7A 5EPEA 3VZBA 1GRRA 4Q3EA 2H4ZA 3A10A 3GI1A 4KGZA 5AJZA 2QU7A 3W0LB 4D56A 4K9MA 5IANA 4FX2A 4LTNA 1QTNA 5K0BA 1V39A 4EPTA 4B8YA 2JD2A 2JJ1D 4J0IA 3SHFA 3OEHA 4HNAA 4IMPA 5DK6A 3Q3CA 3AFNA 4EY4A 4KX3A 4H6PA 5IWCA 5D7BA 3P4XA 4GM0A 3PC4A 2X3FA 1OGIA 3I45A 2UYCA 2P77A 4KLNA 3H1TA 3EF0A 4LZZA 4PG6A 5K8LA 3I9MA 4EFDA 1Z06A 3R24A 4MCHA 1VSBA 2ODQA 1VLHA 3FRHA 3KOMA 4HMPA 3G2KA 2Q7OE 4D0GA 3FOEC 4RXTA 1IM5A 3TLGB 4U6SA 1GKIA 2F4NA 5FLEX 4J2HA 5JOQA 1GSHA 1CUVA 4QHYA 2O54A 3Q9LA 2YHAA 3W6OA 3LHDA 1JB1A 1PP4A 4ZYVA 1RWWA 3VJMA 4C0LA 1LI5A 1KRHA 2A0UA 3L6EA 2WTUA 4R9RA 4KG7A 4OGGA 5SY9A 3QSGA 1O9HA 1GPDG 2WQZA 3L8CA 1FRZA 5EMKA 4AJEA 4MWTA 3WKEA 3CX6A 3ZCSA 1Y4SA 1JE0A 2Z2IA 1VPDA 3L1VA 3ONNA 3UUEA 3EIUA 4FINA 2RGAA 1WSBA 1SC6A 3Q88A 2L82A 2J5KA 5EZYA 4KPGA 3TX6A 7AT1A 3DBHA 3SQOA 5K6AC 5KO2A 2ORYA 3E0XA 2QV7A 5C4GB 1KEEB 4I4TA 4BBPA 3EQ7A 4RKWA 3AEZA 1TD1A 4Y6OA 1J1UA 2O14A 5A5VA 1R4NB 3MWJA 2BY4A 5DTRA 3DR3A 2YZ2A 4EHNA 2QLBA 4CNQA 5KKNB 4MQ5A 5LA6F 3BQMB 3P4UA 4K6FA 4MB2A 1Z0DA 3EDMA 5EMHA 4OJKA 1QDUA 3CRRA 1JDNA 3QHAA 4Q3DA 4WE3A 1LDBA 1W88A 5CPFA 1DNPA 3EIWA 4ZT2A 2W22A 3VU9A 4N8DA 4CODB 1K68A 4KIUA 1RKQA 1F3LA 1ZOOA 4PF1A 1K7EB 1NL3A 1QFJA 2BCJQ 1TU0A 2P9TA 3VFDA 5KDOA 3WZMA 3KQLA 2XYVA 3O83A 1PYDA 5EGSA 4O3MA 3V1NA 1W6RA 4BX9A 2QI9C 2YOGA 5JFGA 4YAUA 3EDOA 2FDCA 3K5PA 3Q7PA 2C4KA 4ITUA 4QOSA 3KHTA 4ERXA 4CEJA 1ZJZA 3UW3A 2EWWA 5JJ5A 3G82C 5BP7A 1MJNA 1YE5A 4HZUA 1UK8A 2VHUA 2X2PA 4IJ5A 3A25A 2GJAA 3ZDFA 1FFCA 2WMDA 4GAEA 3AUSA 1XR3A 4TMTA 4CT4B 4MV3A 5A4DA 4HGYA 2DJ5A 3ZV5A 3QMWA 5GONF 3SF0A 4C2BA 4P86A 1UBKS 2JLWA 2A7XA 3DC2A 4IOJA 1C29B 1OAAA 3BD6A 3USES 1SXJA 3K0FB 4BNJA 2ACEA 4DOMA 2OECA 3E7WA 4WLFA 3LVRE 1T5LA 2IHZA 3BJRA 3ESCA 3O38A 3FX2A 1V96A 1XHEA 3RUIA 4JJ7A 5FOXA 2DY1A 1V4BA 5F77A 3SIPA 1EFVA 3R3YA 1M6HA 2NXCA 3DM9B 4KKXB 4QIHA 5M29A 4M1WA 1D8TA 1Q0UA 3ZDBA 1FTQA 4HUTA 4Y2TA 4IIYA 1M0TA 1OXSC 1G66A 5AH0A 3C24A 5ERXA 2ZRCA 1R6AA 3C3AA 2NXEA 4P53A 4GMGA 2OQRA 4A3SA 4WN9A 2DUWA 3B7WA 3TOCA 1D1PA 3NBFA 4DMMA 1UOOA 2YFKA 3EAQA 1WEKA 1WR8A 1I9GA 2J4DA 4JP5A 3NGXA 3NC0C 1UJMA 2UDPA 3O26A 4QYTA 2N75A 5TMBA 1UFKA 3IHLA 2HSGA 2QOEA 4Q39A 2YZ7A 2QVLA 3W9YA 1NYLA 1EJ6A 1A96A 1RE0A 1T6ZA 2XNSA 1YQQA 2HRBA 2Y71A 1JAHA 4GRAA 4K9LA 3TNLA 2XDYA 2DLCX 2HRCA 1T8SA 4ZCMA 2K6GA 3EEOA 2L19A 5KC9A 5FB3A 3HFJA 2ZUTA 2UZ1A 1I5RA 3B78A 3Q15C 3UHPA 2E5LB 2C5AA 1TGVA 3DDUA 5AXCA 5ALXA 1T3TA 3TQTA 4BN4A 4E5MA 3CX7A 5E1MA 4F9EA 4EB8A 4FJ1A 4MPRA 2V96A 3F74A 1TCUA 3OHSX 4DCJA 1Y3AA 4FFVA 3PXDA 1H2WA 2R8BA 1TK9A 2Z8YM 3D7SA 2J4FA 4IDFA 721PA 3CRW1 2O59A 1Q1QA 1DB3A 1XNJA 2OXFA 4TV9B 3S44A 1HUQA 2I4OA 5EPOA 2YXEA 3NHFA 4RPLA 3CUUA 3DC7A 4MQ4A 3W4IA 1AIPA 2VHVA 3ZTYA 1X2EA 3GAAA 3AR6A 2J09A 3MGBA 3MNFA 5BNWA 3AXSA 3RM3A 1I2CA 2R6JA 4BX8A 5JAUA 2OZKA 2NSJA 5D1NA 2WV9A 3Q8XB 2VQEB 4CNBA 1LBTA 4A6PA 1JHDA 2PUHA 2XUIA 3O82A 4KOAA 5U4XA 4MYSA 3QTBA 4LIPD 4BV8A 1AXEA 1DBPA 3ZGYA 1QGAA 3LX6A 3KUUA 2P11A 2Q50A 1DTWA 4WOBA 2P0EA 1N0WA 4DREA 3TXXA 4D0LB 2EIHA 1NM5A 3L0PA 3PXXA 3GJ6A 2R8PA 3N0RA 5DWQA 3GELA 2R8EA 3GLIB 3OJLA 3TX2A 5BYKA 1MQ9A 4POAA 1JDUA 2IYXA 1VIYA 5HE9A 3VO9A 1DE0A 1WW3A 3BTUA 1DAMA 1GUYA 1OZFA 3TIIA 1N6PA 4F8YA 4GDMA 2CDRA 1Z4LA 1TUEA 1OYWA 4PG7A 1U8UA 4RMNA 2D1QA 3EPKA 2PRKA 4TSKA 4YUXA 1IOVA 3IAM6 2A0FA 3IYLW 4H4EA 4R7ZA 3RBVA 4LAFA 2RGRA 2CZCA 4IYJA 1HV8A 2EJCA 1Z75A 2OWEA 4INPA 4OUDB 1YVRA 1A9ZA 4BKPA 1V3TA 4I1OA 4B09A 1W36C 3GD5A 4KN5A 1NNLA 1T0UA 3CSUA 1P7ZA 3D6TB 4F3KA 4PLZA 4RIHA 3F73A 2W00A 3IO5A 1BO6A 4HAVA 3DTVD 1Z13A 3QFRA 3DF9A 5JEEA 3RE1A 4MSUA 2HSEA 5FUYA 4X20B 3RYTC 2C54A 4G8JA 4PFKA 2H29A 2NSYA 3NTLA 3O5AA 4TMVA 1I6LA 4J1TA 5DGDA 2ZE5A 2H1CA 3CRMA 3VDNB 3ZV7A 5TRTA 4BAGA 3O91A 2X7HA 3DMYA 4XM2A 3JQBC 1G7CA 4Z1OA 1ZKMA 1LBQA 1Z12A 2CUTA 2PCJA 2ZKIA 3KL4A 4HNRA 1UJCA 1JLMA 5HIMA 3PFFA 2E2WA 1VE3A 4JQYA 3ILHA 3KOUA 1M2VB 1BGVA 1O8CA 4OKSA 3SNKA 1TPYA 3IPCA 2H2GA 4EG8A 1RKXA 1TYAE 2QIOA 4RLHA 3AZPA 1H6BA 4MRMA 1SURA 1YRQA 3HB1A 1FFBA 1OV4A 1CSEE 1XVVA 4HMOA 4BP3A 4EYOA 2BP7A 3QQPA 3DT8A 1GEEA 1QHFA 1SCAA 4YJ3A 5KYVA 3ZWBA 3OJCA 4KREA 1FYWA 3A1WA 2FGJA 4QYXA 1WMAA 1KYQA 2OD9A 3B1FA 3OCCA 2A9KA 5LQMA 1P33A 2GX6A 2JFVA 1J0DA 2OAGA 5ENDA 4EPVA 4TLLB 3K0AB 4OQEA 2JG3A 5SZKB 5MFZA 1ZMRA 2YV2A 4TV8A 4TWIA 2IV2X 4WA7A 4DPLA 1ES9A 2VHEA 2DBRA 4ZU6X 5AVKA 3G5MA 1RWNA 4RVCA 5EUBA 3K6SB 4TXMA 4Z4CA 3E3LA 5AHKA 3HDTA 4YJ2B 1SHLA 1UL1X 1J7JA 1WPXA 1GNTA 2ONZA 3K4PA 4D9NA 2XNHA 3GXBA 3R3UA 1URPA 2B4YA 2JEZA 3NM6B 3DW3X 3SEZA 3E18A 4W1QA 3PQ3A 1SVSA 1OLUA 1TMGE 5ECDA 1ZISA 4B87A 1BN6A 1SHKA 4P32A 5EFOA 3AY3A 1P3DA 2H51A 2HMAA 2VA9A 3BQNB 3WG9A 5AIBA 5G1OA 2C42A 1LKZA 2ZUUA 4JLAA 5FBHA 4DUPA 3ESYA 3QLUC 4WXMA 2XJ4A 1B76A 1Z37A 2WHPA 2A7QA 2M9MA 2R6ZA 2V98A 2ZUSA 1ND5A 1F7UA 2B98A 3DDWA 1MG5A 4ZU3A 1F4LA 2B8JA 1PNOA 3IBTA 4JBNA 3SZRA 3DH0A 1SXJC 2AHOA 3P9IA 4MP8A 3F4LA 1F1BA 4NR0A 2IF0A 3U9SA 4AY4A 2C9DA 1CQJA 1VE6A 4HQ6A 1XXHB 2Q4EA 3PHLA 2ZYWX 2YHIA 1SCUB 3DHEA 3N39C 4NZZA 5KMGA 2BTEA 1NY5A 1H93A 3TMAA 3COJA 1C9YA 3EVZA 4ER3A 4LJ8A 4CKCA 4YREA 3CSSA 2ST1A 2XNDD 4DDMA 5EP1A 2AJ8A 1Q7TA 1CQZA 4Y2GA 3J81A 3LRPA 3ISJA 5BNIA 3E2IA 4QTXA 5HF8A 1NMZA 1Z5UA 1G1MA 1MO6A 3DAFA 2WDPA 4JBLA 3RAJA 5MGBA 2ZULA 4IQGA 1XRQA 3EVCA 2LUOA 1WQ3A 4WXPA 1UBJS 5JRJA 4PQRA 5B30A 1KOGA 1VIAA 1YZFA 1P1FA 1PR5A 1YC2A 4UDNA 4XGQA 3A4VA 3WV5A 4E5VA 4WNIA 2POQX 1IVNA 3OY2A 1M2OA 1LJLA 4PWZA 2V0NA 5HUJA 4X8LA 4KHZA 3V6MA 2NXNA 1GM5A 1D1TA 3D0KA 4KPUA 2F1JA 2UZAA 1X8XA 3O8OA 2Q6KA 4FYKA 4C4XA 1PNRA 3R5KA 5ES3A 2AOTB 2R4UA 4PWYA 1Q7BA 2GJ9A 4HP8A 3N5KA 3A26A 4TKVB 1BVYF 2WM9B 1UJ2A 4WOKA 1OPRA 5EJAA 5A4IS 3V8QA 3JYPA 4BO0A 4YRTA 3BE5A 4M7OA 3CIOA 3M70A 4GP6A 1NRXA 3EZ9A 3JYHA 9ABPA 4ZCIA 4YR7A 3ZOZA 2XHZA 3IIMA 4KWTA 2O5VA 3S2YA 4ZT5A 4HS4A 1UBFA 1J0AA 4IRUB 4RTOA 2NAFA 5BO5A 2ZJYA 2D5BA 1NBME 3NYRA 2IUUA 5K6TA 3G2JA 1KDPA 3T7TA 2V6MA 4LDPA 3ZG6A 1XEXA 3RK4A 2FZKA 1W2HA 4V0MA 3ZGLA 4WVFA 4HD8A 2Z5FA 1Y1SA 4XYBA 4OK5A 3LZ6A 4LJAA 4FFBA 4W9MC 1CJTC 2IIBA 5F73A 3C6KA 4OHPA 3PWSA 4II2A 3L7OA 5LQAA 1ONOA 3D64A 3N2GB 2QGNA 4ZCRA 4D4KA 5LYYA 2IKSA 4Q4JA 2IV3A 1BHO1 5KJ6A 4F3NA 3V8RA 3PIDA 4MQEB 1D5WA 2FY8A 5KINB 1OGJA 3MS7A 3DZKA 4Q6BA 1XDDA 4IAOA 4TX1A 3A4MA 3I9NA 2W11A 1DDIA 1NLZA 4J1QA 1NOKA 4MI3A 4TUYF 3NASA 1K86A 4WD3A 3DNFA 3KB8A 5SV2A 2WNSA 3JAKA 3UJAA 3UXHA 3HFRA 4KE9A 5LZ4A 3WLPA 3BMCA 2HA4A 1EFPB 2BLNA 1QONA 5D01A 3VR3A 1V8ZA 5B5SA 4EX6A 1YRHA 1OREA 4M8IA 2GRUA 4P84A 4RNCA 1RXWA 3PI7A 5AXDA 1J39A 2JL1A 4PXSA 1W581 1PK8A 1YHZA 2I2CA 2LWIA 1YULA 5BV1A 1K8ZB 1E7SA 3IS3A 1Q7RA 2BN4A 1QHYA 4LCEA 3NEJA 1UQTA 4ETIA 1BKDR 4F3RA 3NDPA 3T9FA 3CINA 2I22A 3M2TA 2XA2A 4TYPA 3T4EA 4EKGA 2QKYA 1FSGA 4HDRB 1OB2A 3G6KA 2V03A 3GHYA 2WT4A 2ZCVA 3G88A 1M75A 4KXYA 1F0PA 1SQ5A 1JSRA 4QUKA 3UJCA 2ATIA 2G25A 2C1XA 2MDTA 3ZWNA 4W5QA 3I9V1 3BCHA 4PIPA 3TM4A 1A5SB 1T0BA 4KBFA 2YWXA 4OQDA 2XBMA 4PZDA 2O2CA 5GM2A 4BV2A 3LTNC 3HXOA 2ILTA 3L7YA 2P4SA 4X97A 3LPCA 3ETGA 1YOVA 1NR5A 3G1TA 3G89A 4FHCA 4FLFA 1NC3A 1ONSA 3CZ9A 3Q87B 2I7DA 2P69A 4RCZA 5F98A 2CYAA 1DHRA 3AHJA 4EFLA 2GARA 1Y42X 2HI0A 4KW7A 2Q5CA 1XNRB 4ZGGA 5H81A 1W59A 5AK4A 3R20A 5KX5A 1KWKA 5CVEA 5G4KB 3KTFA 4RXMA 1JBQA 1Z17A 1IQRA 1X42A 3DDSA 4FE7A 1USIA 1YQWA 1QH0A 2WMOB 4TTAA 1MQSA 3E27A 1NUPA 4LDNA 2XB8A 1REQB 3WGGA 4AAYA 2JK1A 3QLEA 4DVGA 1D4OA 2HYDA 3E70C 3EXEA 3MQFA 2ACVA 4BVKA 5CB8A 5CFZA 1WOYA 1C7IA 3U4IA 1AGYA 3N0XA 4PQFA 4L22A 3TOZA 2NUAB 3G5UA 4E07A 1AKUA 1N2HA 1NF9A 2JIZD 2PX5A 4C4AA 3IT3A 3R0QA 3EC7A 2YWEA 1GT6A 4G5GA 2GZRA 4C3ZA 2LPMA 3F90A 1NI5A 2VBCA 2QB5A 2ZJBA 3DAPA 3ROQA 2JKYA 5ITSA 3PNLA 3LQRA 5CA0B 4DYHA 1OTYA 4J2OA 5LMCA 4BKOA 4K6MA 2O7SA 1XMVA 2QRUA 5B64A 1PJ8A 3TFOA 4E88A 2X9NA 4J2TA 3ASVA 3KJHA 2OGSA 2V7GA 4IWNA 4D25A 2XKKA 2PX8A 1JHUA 3DVSX 3PXCX 3WNDA 1WO8A 4D3ZA 4W7IA 2QRZA 3H5NA 4H17A 2AQIA 3UUGA 2RKBA 3O03A 4R1NA 1V8BA 1EWVA 2AI1A 3DV9A 1ADFA 1DC7A 3DYVA 3ETCA 1PCXA 3EZGA 3H2KA 4LNHA 2DZDA 2XTNA 3LUCA 4YR9A 1KO5A 2J59A 4FJ0A 1G5PA 3U3JA 5A1JA 1U9IA 1FRQA 5B3JC 2BH2A 1SXPA 4Q9AA 4MIKA 3OC0A 3WO1A 2PUCA 1UP4A 4F4IA 1O0SA 3P45A 3QEKA 4DL9A 5AD1A 4BVBA 4F38A 1SJ9A 1TKAA 2WJHA 3W6NA 3ZWCA 2PZGA 5AW2A 2ZRLA 5JNRA 5ISMA 1FC0A 1L2TA 3VZPA 4BCDA 1M8JA 4D9IA 2CVOA 3OCZA 2ZVJA 1XF1A 1CJSA 2NVBA 2NVOA 1RLTA 2FEPA 1LV8A 2IXAA 3F9IA 1L1QA 1NVVQ 5TNXA 2LDBA 3U44A 4C2TA 1R4NA 2PGNA 1FB5A 4J07A 2RJNA 4N0DA 3HB4X 4P80A 1EUDA 4HWKA 5EHQA 2HO4A 4ZT4A 4E3WA 2IHNA 3STTA 4E13A 4B48A 3I2IA 4UDOA 3UG7A 2DLNA 3GJRA 5EEHA 3DV2A 4QGSA 2WD8A 3CURA 4UUOA 5ALPA 3UY4A 1P0FA 1JQKA 3BJZA 3BT7A 2RI6A 3CS3A 1CZNA 1OXUA 1RM0A 2Z3WA 4X44A 4DAOA 1A4XA 5DYNA 4DSZA 2VXBA 3MWKA 4JC4A 3N2ZB 2O5EA 9ATCA 3B5EA 3L8MA 5KYWB 1WCWA 1X0XA 3O3MB 2LKCA 1C0KA 1EAMA 3OM0A 3B1YA 2AEJA 5FPPA 1EHIA 2P79A 4R1QA 4RVFA 2DWOA 4J1TC 4DMGA 5D3QA 5EPUA 3CVXA 2RCNA 3HM2A 2NU8B 5DXAA 2QD3A 4DC9A 3N70A 5EE9A 1TTTA 3EXHC 4M0UA 5C8YA 3DZJA 1Y9EA 3IB6A 5TMEA 4A10A 4LFAB 4KXFB 2WIAA 3URKA 3WHIA 5ADUS 1V5IA 5DE3A 1HTBA 1U1EA 1MVOA 2HA0A 4G0MA 4UU7A 1CY6A 2JGJA 4LY3A 1TM3E 2XE8A 3WIDA 1G9XA 5M34A 1LPNA 4YMWA 3UM9A 3Q7RA 4CLEA 2Q0QA 2G9ZA 3DF7A 4L9SA 3PRYA 1NVDA 2QXTA 2O9JA 4PYQA 4LMAA 3SHOA 5C9ZA 5KS2A 1P18A 3LV8A 3NG1A 2PLRA 4PRKA 4PZEA 2JIZA 3IH5A 2FMXA 3U48A 4QLBA 2X0EA 2XMZA 5BWOA 2EP7A 2YYAA 1AUVA 1KYIA 1U99A 3LJKA 4KH1A 4LBZA 4EY8A 5BPHA 1VSQA 4O2RA 3EZ7A 2B94A 3ACCA 4ZO8A 4ZVKA 4RY2A 2LZ0A 5TS2A 1SUWA 2BFFA 3JQDA 1Y7TA 1KQFA 5F35A 2O57A 4LYGA 5A9SB 4ZYLA 2ZTLA 5DGHA 5IDYA 5EMMA 4CM7A 1IZ0A 1M2EA 5EHIA 2Q99A 1MT3A 4G85A 3SFVA 1USUA 4HDQB 3C74A 3TQHA 3FYUB 1JDSA 3C6MA 2NZJA 2ZUWA 2JFQA 2MSWA 3PIRA 4HTFA 3B9RA 2ZRJA 1QFMA 4UDXX 2VJCA 1VYTA 2ZIXB 2XVMA 4NG4A 4QQRA 3K4HA 4Z7NB 2AN1A 3WL5A 3MA0A 4NFYA 5TPWB 1B1AA 3VI4B 3LA6A 4RTSA 1E0AA 4GP9A 2IIVA 2RGCA 2XMCA 5IT9A 2VSNA 5FV4A 5ALZA 4QUJA 1CZLA 2HX1A 1ORDA 5IAJA 2C2MA 3VU8A 3VZDA 2JA2A 1R50A 1Z56C 2XNKA 1BDBA 4FFPA 1EFLA 5A04A 4JDPA 5CT4A 4Z53A 1JR3D 1BS9A 4FEYA 4J0EA 5CHEA 3D3EA 1WPRA 4L75A 4YQFA 3KKEA 2IOFA 2BBTA 4FYHA 3GH3A 1UAGA 3LRXA 1KI9A 1TRKA 4M38A 1SA0B 3QM1A 1T0IA 1GNSA 4F4DA 3COYA 4X71A 4P4SB 4PC6A 2XDAA 2CFIA 1NN1A 3D6JA 1TM7E 3IALA 3AZQA 4EGCB 4FX5A 1M5UA 1KO8A 1TYZA 5B4VA 4IHAA 2F3TA 4MR8A 1M34A 4G23A 5IVIA 1HYHA 1UM9B 2VSOA 3H04A 4HGNA 1T8YA 1X39A 3V33A 3ZI0A 1INLA 1VCOA 3A6LA 2CXNA 3RYFB 2F48A 3R0VA 3SZLA 4C7XA 2MYUA 3DE2X 5I3CA 4V1CI 3GFPA 3AKDA 1MABB 3B13B 5DSZA 4A0GA 4IUCS 1D9ZA 4S35A 3ZC3A 4CF3A 5C46F 4ARCA 6PFKA 1C7QA 3UJBA 2QM7A 3FTQA 5CA1A 2JLCA 4BIIA 3OZSA 4TXJA 4GXNA 3ROTA 4QNNA 2JHAA 2PQ0A 2ZROA 1R4ZA 1BW9A 1EE2A 2Z9CA 2LCFA 1B42A 2GNAA 1CQWA 3EE6A 4MWCA 1T9HA 4DRXA 1YGPA 2E21A 1PKEA 3L6UA 1W0CA 4BKMA 4Z0HO 3G0HA 1I3OA 2ZRKA 2AG8A 2JAQA 3A0UA 3KWLA 4FP9A 4TTIA 3HLYA 4HB3A 4DLWA 4EZBA 3N0TA 2GZHA 3GP5A 1JI3A 5AHWA 1I5EA 4ZARA 3TRIA 1YK0A 4P8RA 5B6IA 1KYWA 4FNGA 3H5LA 3JD0A 3AXTA 5DM4A 2QW8A 3RIYA 4LJ9A 1GGFA 3LP8A 1GPKA 2J6CA 2W6PA 3B5JA 4R2JA 4TS4A 4ZQBA 1E9SA 2BRUC 3BHMA 3LYLA 2OESA 2R44A 1E89A 2W98A 4RLQA 4UEKA 3TQIA 2QPOA 3MMPA 3V3KA 4LYEA 4REQA 2HTEA 3ZI4A 2PH1A 3D6NB 1AF4A 1NAIA 1GLNA 1I2DA 2VPIA 3DOJA 4H4DA 4OSEA 5AM0A 5KDLA 4ERNA 4I4NA 5LP6F 1HEYA 3R3SA 1COWD 1JEQB 1VGRA 3DEAA 2ZYIA 3VI3B 4EJ2A 1YB5A 2H9AA 2HWKA 1UT8A 3KZ1E 5GJBA 3S2SA 2AG5A 1LX7A 3HS3A 1Y9AA 1P3JA 1GGNA 1KJ9A 1UMKA 2ETVA 2SKDA 3JQRA 4KDRA 1D2MA 1KYYA 1Q20A 1TO6A 3FNHA 3ER6A 4CV0A 1KMQA 3E1KA 1P31A 2ZIZA 5FCDA 3HY3A 2PS1A 1SHTX 3DAGA 1EHYA 4FMCF 4GXQA 4BMYA 3B6JA 4R1MA 2Y0BA 3SR0A 3ETJA 2TMDA 3PWTA 2O8EB 1JQDA 2DPGA 4QOHA 3Q8WA 2W4MA 4UU0A 4KQCA 1CS4C 4LUCA 4CU5A 4DNQA 1ODLA 3MFQA 3QE9Y 2P9GA 3N3AC 3VNAA 2ZFUA 2O8EA 1PWZA 3OEYA 4NCAA 1SD1A 5FLKA 2O52A 3M7IA 3ZJUA 1KO4A 2DWCA 5BNZA 3ZJVA 1KJ8A 3A04A 3HBJA 3A0RB 4HLDA 3B3JA 4EYKA 5JSZB 4MHSA 3VQTA 4A26A 3GJ3A 3LY5A 4BKQA 2ODEA 5K8IA 5KQSA 2FFAA 4PZCA 3JPYA 4P4GA 3JWEA 2GAFA 4QUAA 2XGGA 4IEIA 1JEDA 5DLYA 1CKEA 5LBUA 4F5EA 3JCZA 1MNAA 1QGYA 1DFGA 3MAGA 2HT6A 4IDQA 2EHJA 1PG2A 2PO5A 4NWIA 4MK4A 2ANBA 1WZCA 3KIPA 5G1NA 4EW3A 4W5OA 3PQEA 4EJSC 4F71A 5L3SA 4GI7A 3I83A 5EE1A 3LX4A 4AO6A 2ZWMA 4RHEA 3ET5A 3KQYA 3OQMA 4I5GA 1Z26A 1G21E 2PMCA 3P9CA 3U4DA 2ZJ1A 5IABA 2W4QA 3HCRA 5JSQA 1RJDA 4Q4JB 1ADJA 4HS9A 1YCGA 2ZPUA 2TSYB 4JIGA 4L07A 4CQMA 5A6VA 4PPYA 2ZE6A 2QPLA 1QPGA 1Z38A 4Q7JB 1KTIA 1JHMA 1OHHD 5LKRA 2FRDA 2JCVA 3ODGA 3D8NA 4Q02A 3CRNA 4X7MA 3O8CA 1V9LA 1T4GA 4ON9A 2ZU6A 4WKBA 4V1CA 3LCVB 1KNQA 5LYJA 4RTMA 2H2AA 4KBGA 5BOSB 2QAJA 3F6PA 1Y8RB 5TQ2A 3KTAA 3PEEA 1DKLA 2PUWA 2X1VA 1QYCA 3OZCA 1E62A 5CW1A 4WXRA 4DA9A 1RE1A 3RR2A 1NW9B 4ITVA 1ZAYA 1N9KA 5LQCA 1NMXA 2JGLA 2BFMA 1QGDA 3M5DA 3O8DA 3MJTA 3PE3A 1CUFA 4P3XA 1HMPA 4L8FA 4QGAA 4RDXA 5I7VA 5CITA 2AOUB 4I4TF 4GZMA 3RFFA 4I50F 3TFWA 1Z6YA 2O7VA 5DLEA 4Q05A 4UREA 2YXBA 1OI4A 4CQLA 5AW1A 2WSBA 3UAGA 1TA9A 3S8MA 2FPPB 1QMPA 4C0BA 1KH2A 1KZ9A 1UK9A 4AI6A 5JYDA 4U2GA 3MOGA 1L5HA 1NXTA 1DO0A 5CDUA 3AF1A 4O4LA 2E4VA 4HQ0A 3WNVA 4CRWB 1BQ3A 4BBZA 1ZJWA 4HBZA 3RAPR 2H54A 4FFOA 1P8JA 1PZFA 1TJ4A 3L49A 4J0KA 2FN9A 2WV7A 3JSAA 4K9OA 5ALMA 3RJ9A 4IF6A 1H0RA 1A4UA 4LHSA 1X8KA 4PO9A 1V16A 1Y9DA 4KXWA 3EIHA 1XZ8A 1SCJA 2CXHA 1GAEO 1U6KA 4FGZA 2R6AA 1Z0KA 1W35A 3KXKA 5DGXA 2C3UA 3PUJA 1L1RA 1F6WA 1RXCA 4JVMA 4CCWA 4B5KA 3AL3A 5JECA 5C0OE 2PWZA 2ZUVA 5AM2A 3A6DA 1XKQA 3BMNA 4YALA 4G1FA 4DV1B 1PL6A 3AP2A 1KH1A 3GEDA 1VHQA 1NKSA 3FAKA 1UC4B 2P2ZA 3K05A 2YUTA 3B7GA 3QE3A 2FMFA 2PL3A 1P4GA 2HAEA 2XUPA 1XDGA 2VJNA 3EXFB 3LT0A 2XKJE 5EJ2A 3TD9A 4RBNA 1ORHA 3Q98A 4PYRA 2JDID 3BSYA 3HP4A 3WWOA 4ZI7F 2VXYA 5JZ9A 1B93A 2WKPA 3BGVA 3L41A 4G26A 1T6BY 4J91A 1WTCA 1KC3A 2X9GA 5T6BA 1W49A 1W44A 4HWTA 4REMA 2HU5A 2VTBB 2ZZMA 1ZSYA 2BFFB 4XOUA 2D59A 1QDEA 2MSDB 5EA2A 5BYBA 1LBHA 3WB0A 3PP8A 1T9CA 4NRDA 3D3QA 3B1ZA 1YDEA 5ALEA 4CTKA 3T5PA 1FE8A 2C82A 2ZS7A 1IEWA 2YWFA 1GFWA 2DT5A 1RKUA 2B78A 2FEMA 2QPTA 3HP7A 3K3PA 4MUIA 3IQIX 3IVXA 1T5DX 2QSZA 3L7JA 3O9VA 4G5OA 3FYUA 4KIWA 3Q3GE 4M1MA 2ZZNA 2H5IA 4YAFA 1LS1A 5PNTA 1H2YA 1RM4A 3UAXA 1QHXA 4XRRA 2QVCA 4K28A 4AYWA 4L9WA 4MV9A 2D74A 2DTXA 4TMWA 2LBPA 4TMZA 3QXJA 2E0IA 2J8ZA 3OPNA 3ZZ0A 5T4FA 5HZKA 3R3VA 1Z4IA 3FCCA 3LQKA 2HDWA 2YNMA 3GLKA 3NUGA 4RGVA 5BT9A 4D6PA 2NZ8A 1SA0A 4ZMRA 1CZUA 1H6DA 3V8MA 2FMHA 5HQJA 2PQMA 3MBIA 4ZO7A 2QSUA 4CMBA 1DPGA 1OBOA 2XVAA 2ZQ5A 3JZFA 2P6RA 1YJXA 2O5RA 2R8XA 2X9QA 2ZBGA 3DDOA 3W5CA 1VI2A 2QRVB 4E5SA 3VX3A 4ALNA 4EHIA 5IZCC 2B21A 2WJIA 2H3HA 3PR2B 4O02B 3TDKA 1RS0A 1IHPA 1WWKA 1XD8A 2B4AA 4ZEVA 1F17A 3K2QA 5KVCA 3JALB 1T8WA 1DC3A 4OHCA 4W9NA 1M0SA 5IKEA 3ZBPA 2DYKA 4DMRA 4AS3A 2WF7A 4CM6A 5JMPA 5HP4A 1UMDA 2XQJA 4BLTA 3QXSA 4C3UA 4FYIA 4QU5A 4MUGA 1MFZA 2Z98A 5B58C 5A4MS 3C3EA 1C1DB 5T4HA 4IR7A 4EHFA 2O48X 2WG0A 5KYXB 2CC2A 3CLUC 4WV3A 2CVPA 2XZDA 4CIXA 1YQEA 5FOUA 4P6VF 4F21A 3E9RA 3RYIA 3DEJA 4Z86A 4YONB 3ZE6A 2H52A 3FFXA 1S7GA 2NP6A 3O1JC 3MZ0A 3G8YA 1N2JA 2RDMA 1X1RA 3N59A 1YH3A 5KOHB 2GM9A 1AB6A 5TIIA 5BN5A 1N6NA 4EWLA 4EHAA 3YASA 4Z3KA 4DA4A 4HAWA 3VSDA 3OE1A 2PWAA 1DQNA 3CW2A 3HEBA 3G2IA 1EESA 4ZOQI 1ZCAA 3DTNA 3IKLA 2XSZA 1M1NB 4KBYA 4WCFA 5AUNB 2Z9DA 5FO0A 1MAUA 3IXMA 3G8AA 2QJRA 1NDQA 3HKBA 1Q1AA 4E7PA 4EHDA 1GL6A 4LGYA 5HUQA 3A6JA 2P2DA 5F7JA 4M9CA 5IKOA 1OT3A 3DOHA 2FB9A 2C7BA 4J7CA 1HK7A 2E55A 3SYLA 3T5TA 2FFBA 3ZHOA 5FR2A 3IQGX 1HFWA 2EXXA 4JBYA 3OFSA 5T5QA 3CRZA 2R62A 1WXIA 3ESBA 4I1IA 4UAJA 3SJAA 2VPZA 2ESRA 1CULC 2ZI7A 5HJ2A 5SYMA 5CD9A 3NEPX 5JEDA 2BPOA 2O0MA 2QTNA 4MDFA 4RTKA 3SBDA 4L8WB 5E9AA 2HPVA 2YN0A 4CN9A 3JRWA 1R4MA 1Z47A 1F0KA 1XE3A 4HQRA 4B6SA 4E2YA 3CVUA 4F6RB 1N8TA 1YB6A 2JVKA 4C7KA 2CB0A 4RX1A 4UBNA 3VHLB 1U0HC 2KE5A 3TR5A 5KQPA 1T8RA 3VZQA 4DCGA 4RGBA 1VLQA 2DHEA 2EEZA 3BJIC 4F4CA 2J31A 1YFKA 3D7MA 3EG9A 5JC1A 2UUOA 1XFDA 4XM1A 3F8SA 4QLOA 3DXXA 1FS6A 3EZFA 1KEVA 4AZ3A 2ALJA 3UC9A 4IUDS 1Y9ZA 3FBWA 5LQRA 1QU2A 4OXXA 3TLZA 3B53X 2AL7A 1GZ7A 1FA9A 2RC6A 2ZRPA 3FMIA 4CI0B 1DAGA 5LWHA 3KQMA 3EFEA 4YI3A 3T7SA 1YRLA 3I2KA 3MT8A 5AXAA 2HKIA 4YWHA 2B20A 1VECA 2OK8A 3K0CA 1ZESA 2V4UA 4NESA 3IV6A 3M6AA 3MUNA 5DHFA 1T2NA 4AECA 1N3YA 1WXHA 4TMFA 1GZ6A 4R2KA 1NNEA 3U60B 3I30X 1M7HA 2CE7A 2O8VA 3AOGA 1C2TA 3SSAA 3FVWA 2H07A 1A9RA 3CTPA 3JR3A 3DE5X 4JBHA 4JB2A 4RADA 1EAYA 1P45A 3JRXA 3OD5A 5GGYA 4ZJPA 2HGZA 5F9HA 2BHNA 4FNAA 4EH1A 1SBCA 4U2CA 3RANA 4AT1A 1Q74A 1G60A 1T9GS 2VF8A 2YJNA 3EY9A 3KFLA 3PLNA 3QX3A 3GN2A 3RIEA 3RUDA 2OB1A 3FXAA 4GNRA 2WJVA 5FUXA 3ZVLA 2ZRGA 2E4WA 2QM8A 3T7EA 4ABTA 5AK0A 3ELUA 1EG2A 2ZWPA 3O4RA 2DR3A 1H66A 2PG3A 4KVFA 1FP6A 4Q03A 2I4RA 2LNDA 5HZMA 1N5RA 5JAOA 1D4AA 1NYTA 1DKPA 4E3ZA 2DBZA 3VPHA 5JXHA 5K2OA 3CT4A 2AVDA 4OO3A 1I7NA 4X95A 5A6SA 3HRHA 2RHWA 4D57A 2YFQA 3X3HA 3IA7A 1S2DA 3IEXA 3L04A 4RCVA 4D9CA 4LHYA 3V2GA 3LYAA 3RTDA 2J7PD 3WWEA 1JR6A 3KZOA 1E3DA 3RVBA 2GAAA 3WK9A 1ULHA 3OQJA 4J94A 2MR6A 1TEVA 3RRFA 1GPAA 1O6FA 1GARA 4KLAA 1R4MB 4LW8A 2JFPA 2EATA 4U2EA 4B31A 2CD7A 5EERA 4Q16A 3VC1A 4C4TA 4N18A 2BEUA 2I7TA 5EJ4A 2XMSA 3OJFA 3PPIA 3FMVA 2YRFA 4G4IA 4C9BA 1EGAA 3JZIA 4TS1A 4JUBA 2GO1A 4HNQA 4AZWA 2D5LA 1HH4A 3EA0A 1VJTA 4U7DA 3O3CA 3K32A 1UPBA 2PDAA 1YI8A 3RREA 4IIFA 4HZUB 3V8VA 1GCUA 1HDCA 3U4GA 1DSSG 3G2PA 1VCHA 2FWNA 4HPJB 5L7YA 3VKUA 4LQ4A 2QE6A 4D4MA 1OFGA 3FNIA 2QLTA 1GAJA 1YDWA 3L3BA 4GI5A 1EI9A 2CMDA 4IS2A 2ZP1A 3LF2A 4CR7A 2ZW9A 4H18A 1CEXA 1XBTA 1TMYA 2HPAA 3D7RA 4A2QA 2QSJA 1ZKDA 3QPVA 2X6TA 3M6XA 4RH0A 4DQKA 3M5PA 3O84A 2MSLA 2J67A 3AT1A 1JSLA 2OBFA 4RM3A 1FVHA 3T9BA 3TOVA 4KQIA 3QEMA 1IY1A 4B3HA 2ORWA 4J90A 2X3UA 1B0AA 1YVEI 2C9MA 4X65B 2OHJA 3CY6A 5EP3A 4FI3F 1ZAKA 3K6KA 1XEWX 4MVXA 4EFMA 2XCSB 1OXKB 2XOKA 2F3QA 3L05A 2NUTA 1NMQA 4C7JA 3ZJTA 3HXMA 5BSKA 2BM1A 5HYVA 2YC2C 3QP9A 4TOIA 1Y48E 1XZGA 2ZVDA 2JCSA 3PTZA 4H1VA 1DBVO 4NPCA 4RSMA 3LX5A 4TLAA 2I65A 3V2HA 1J9GA 2Q6VA 1EM8B 3GEIA 3O2JA 3RVMA 3W8DA 5TF0A 1BDJA 1N3IA 5E6SB 1S8AA 4Q48A 4XCVA 4UOQA 3O47A 4C0JA 4EVIA 3LFTA 3QEOA 1PQUA 3ZBTA 2P2YA 3ROXA 5IDXA 4U5QA 3UXEA 3GX1A 2R25B 1G59A 1N6OA 3HSSA 1AQNA 3IL2A 2BTOA 4KFCA 1VDMA 2K2WA 2V7QA 1KEPA 1IY0A 1HFEL 3PDIB 3U31A 4DM4A 4ZI3A 5KAPA 1B26A 2X6QA 4R1PA 3DDHA 1W25A 2ZBEA 1PGPA 3BWMA 3PX3A 1YB4A 3TJZA 1S2OA 4RKFA 1NM5C 1EFRD 3BKXA 1TT5A 4PNEA 3ZEAA 4BFXA 2D0OB 4PO8A 1VHJA 4IFIA 1WQ4A 3DKKA 3P0IA 4RO0A 4A8PA 4C2AA 5ALNA 1RFLA 1MB2A 1E3JA 5CDFE 4GOLD 2WWXA 2YYYA 5B6JA 1IIRA 2HWWA 3NIBA 4LXIA 4EO9A 5ADHA 4FWBA 1XTTA 3HXPA 4NS4A 4U3JA 1MRZA 1SCBA 5J63A 5C1IA 5BVGB 4YXFA 2IVZA 4PZLA 1S2LA 5EIWA 3LX8A 3BWVA 2TECE 1G8MA 1VB3A 1JR2A 1RYMA 1E2JA 2MT9A 2NTYC 4FHGA 1IG3A 4NNOA 4B6OA 4XEHA 3QE4A 4XR9A 1KRWA 4D80A 2R5WA 1BEEA 5CIQA 4WBXC 4DCPA 1H2RS 3MG9A 4EY6A 5LNK1 1NUTA 1JB9A 2CW5A 4LF5B 2BELA 2X5KO 3DL7A 3NHWA 2EZ9A 2QTHA 1DIHA 5IAOA 3Q8LA 1XZKA 3LT4A 3IEUA 3ZIAD 1FLNA 1N0IA 3NJRA 4GSLA 2EFDB 4HXYA 2GD0A 4M0LA 4PAMA 3ZX4A 3D5TA 2DECA 1JHQA 1DS6A 2Z09A 3PDUA 4TZTA 3WLSA 1FFHA 5FH9A 1V7CA 4EB6A 1UXOA 1X87A 2HFJA 2VNIA 3UFBA 1T4DA 2PFGA 3FUXA 2R8OA 4MUEA 4BATA 3L7CA 3Q3IA 4WOJA 8GPBA 1QYRA 4IQ8A 1FU8A 2QL7A 2ZSHA 3NHRA 2GYYA 2QVYX 2XNDA 4JGBA 1CBUA 2Z4SA 4RKEA 5LJIA 2QIPA 1TEZA 1Y7PA 2G71A 3LGAA 5E7JA 4XYEA 5H1YA 1E6EA 5KREA 3BCRA 3PLRA 4YECA 4G0VA 3NANA 1NRJB 3ZXUB 3QOFA 4ZRMA 1QJ4A 3EG5A 5DNVA 1IDN1 1ZINA 2MU1A 2VK2A 3B3FA 4ZOLF 3OFVA 3IULA 5HX7A 2B82A 1C80A 1H1DA 3CISA 3CLRD 1EGMB 2CKMA 3NKLA 4IIGA 4R98A 5GAJA 4CDGA 4F2WA 3GLGE 2ZI9A 3MTDA 3RVJA 1H4SA 1L4MA 3GROA 2JH8A 3ICOA 4HT3B 1VM6A 2HA6A 3L0OA 1BJTA 3U3DA 5CVVA 4EL0A 2V8OA 4YRIA 1T4BA 2CLCX 4H2DA 2X9LA 4CYMA 1V47A 1FDWA 1OIVA 2XH8A 3BIOA 3MQ2A 3FWPA 4NOMA 3TLMA 2D1SA 1WCIA 5ARCA 4YMVA 5F1KA 2QJWA 5IEJA 1NSFA 1JFSA 3C4VA 1PFKA 3EZLA 3V5NA 2WUDA 1ABFA 1S02A 3LQYA 3ILVA 4R8SA 5F4ZA 4W5RA 2AG1A 2QBYB 1SWVA 1SVLA 3AR9A 3PF8A 1MPTA 3N9IA 2JBAA 3I6MA 1OJLA 2I4MA 3EVBA 3PGVA 3PCXA 1H23A 3VX4A 1IWOA 3KQOA 4ZVNA 3DUFB 3KYIB 1W0JD 1WUHS 4ZAGA 3ZWQA 3ZK9A 4NDAA 4Y6RA 5JVDA 2QQFA 3LQ1A 5HS6A 4P7FA 1KJJA 2QVXX 4JYMA 3GCWA 1J5PA 1TOAA 3LT5A 2PUBA 3K5IA 2VBIA 4QREA 2VRWA 1Y8RA 3EIQA 2HWUA 2X3YA 2ZM6B 4XH9B 2NYUA 5F2KA 2Q8NA 1M33A 1QYVA 4EMTA 2XODA 1HI9A 2I1QA 2EFJA 3K0CC 3MBOA 4U2DA 5KVQA 2J5QA 4D5EA 3O8NA 1G7TA 3TPFA 5KYNA 2A88A 1JG7A 2H06A 1LQTA 2E6UX 5GADl 1GIAA 3E22B 5AVTA 3HDQA 3HFSA 3HXKA 1OW3B 2IDZA 3E7XA 2VYQA 4IY1A 1ESDA 1GTMA 3S2GA 2HSWA 1TADA 2V1XA 1VSVA 1JR3A 1CCWA 1F2TB 3C8UA 2EARA 1J49A 1X3LA 1CIJA 1A7JA 4PVCA 4GL2A 4XAQA 1Z15A 2G4CA 2EF1A 2GTHA 2VA8A 3R0ZA 4IYRA 1E98A 3VO1A 4ZI2A 1B6SA 1ZOSA 3DL0A 4B44A 2HOQA 3S0JA 4UNSA 5DTJA 3T3MB 3WDMA 4DV0B 2ZSAA 4UC0A 1B6RA 1Y5MA 4NEGA 3P0JA 2CL6X 1MO5A 4Q7QA 3CR7A 5KYKA 2A84A 4R7GA 1JA0A 3DW1X 3R9KA 4LE0A 4JYAB 3OI7A 3PUKA 2WF6A 1AHPA 4CG3A 4HGRA 1NR7A 4ZALA 4G8DA 1WXFA 4Q34A 1QOPB 3IOMA 4LVUA 2VH1A 4IOLA 5B12A 1F4VA 3GLTA 4KFTA 2FEOA 1Q84A 1SU7A 1VP3A 4JCCA 4XFKA 1CJCA 4R9UC 2BFPA 4OXNA 4IV5A 5F78A 2I6GA 1XAHA 4O1IA 2OLKA 1WY5A 4I8IA 3W06A 2WUFA 3NP9A 3N0VA 4WVLA 4H15A 1CXZA 3HKDB 4EEZA 1O4WA 2ZTUA 3EGCA 5DWDA 2BZGA 5IHPA 3QENA 3PIIA 3VHXA 1SN7A 5IU6A 1FRNA 1ATIA 4K8RB 5GONA 5FWAA 2QSYA 2JKZA 3O4FA 4RV9A 4CIWA 1N1DA 3COVA 2ZAGA 1OBFO 3AM3A 2J08A 3FRJA 4BP9A 4KLRA 3NKVA 2Q4RA 2H7CA 1O58A 1X70A 3BULA 2TMGA 2FMTA 3KQTA 2G0AA 2R0QC 2VP4A 1OYYA 5E8RA 4AY3A 2B1QA 1EVKA 2CCGA 2RK4A 2Z2KA 3UKOA 5GOTA 1FX0A 2O3QA 4YRZA 4RETA 4TTQA 4XB1A 1Y80A 1OA0A 3HQ4O 3IV7A 4ZCQA 3L01A 5BORA 3CWZA 2OXCA 4G9BA 4YJFB 3WISA 3PR1A 2GEDA 1Z18A 3MD0A 5J3JA 1TM4E 3ZK7A 3BH0A 5JNLA 3BWYA 3F7MA 1OX4A 5AP9A 1VJ1A 4G41A 4MRRA 2QLNA 1GTG1 5H7XA 3ZDXB 1KJZA 4M7RA 3GLFA 2PSHA 3WL4A 2FUG6 2MIIA 5DBFA 4ZMSA 5A03A 3C5EA 2EDAA 2HA7A 5DJ5A 5F3WB 5EIFA 1LSJA 5HIAA 3KXPA 3GDGA 3Q10A 4M0DA 4U7TB 1ZRHA 3R3WA 2ZSEA 4Q18A 1GQYA 2GTPA 5EE0A 5EWMA 4F4FA 1HNNA 1CR6A 4LZWA 3LUJA 4ZV7A 5AW8A 3EBPA 3BMXA 4MO2A 4XB6B 1MIOB 3QU5A 2VCYA 3CF2A 1Z4KA 3PDHA 4JN6B 4AMYA 3A3KA 4XTCS 2IXDA 3DWGA 2OM2A 3K9WA 3OSUA 2PJRA 2W2LA 4FT4A 1REQA 4S3MA 1NLFA 1QIGA 4AB1A 5J47A 5KSWB 3FCUB 1Z8NA 1L5QA 2NPFA 4YX9A 1ZU4A 3AEKB 1VGQA 1KAOA 1DBSA 4I9GA 1ZH0A 1Q92A 4O5AA 1KYTA 1YBAA 1P4HA 1YK1A 4ZO4A 3NIDB 5I8PA 3THXA 3GJSA 1ESCA 3H2SA 3NRJA 3BMCB 4Z9AA 4RKYA 1PK7A 1U28A 4WFKA 4Y2YA 2PPVA 2PFKA 1FQKA 3A6KA 3MWFA 4J3FA 2H4YA 3RVLA 3RVRA 1M8PA 1F3OA 4ZEWA 3FWHA 4AWXA 3UPUA 2GXAA 4JI6B 1XKTA 4O2BF 4QYWA 3V9AA 2WILA 4RENA 2VPTA 3K1ZA 3AHGA 4MWBA 4E6EA 2A14A 3OPVA 3QVTA 4FS3A 3ZYZA 1S1CA 1QZUA 3MD9A 4B3FX 3LKBA 3QA3E 4ZYWA 2QAGB 2IS6A 3WL8A 4QDZA 3VV2A 3I9V6 5CM8B 5J43A 2YN2A 3BEDA 4MOWA 4TWZA 4Z9FA 3DWFA 1ZD3A 1Z82A 1P72A 1YZKA 5DNDA 1FRFS 2R87A 1M2JA 4GR4A 4CCYA 5KQRA 1W0JA 4ND4A 1IG0A 3RTAA 3A3OA 2IPXA 4RFSA 1ZH8A 2OMEA 5SY4A 1XK6A 3DBIA 1CRQA 2A6PA 2IP1A 3OFJA 5FWXA 2IBTA 3ABIA 3IHWA 3RSLA 3ZE7A 1XWFA 3ZHTA 2OD2A 1OCEA 5I01A 2BDEA 1NBMA 2V58A 3DEZA 1U4NA 3A11A 3KP1A 5FWXB 3RRZA 1AF7A 2Z5VA 3ZE9A 3WSVA 4ALLA 1OYVA 4UE2A 1M6EX 4BLSA 4ACAA 1ONBA 1HDRA 2VJMA 1JE1A 3AFGA 4A0QA 4INZA 2Q07A 2WMNB 5BW4A 5BVGA 1TK2A 1Y34E 5IYZA 1KRXA 5AKYA 2QR2A 5A2GA 1NQVA 2X4DA 4JXZA 3NDIA 1RWKA 4MKGA 1RWVA 2RHTA 3LCMA 3U19A 1LS6A 3SP1A 1Z4QA 2X8LA 4JHLA 2OCIA 4B3GA 1AKWA 1QHNA 5J4HA 3A06A 1COWA 2GHTA 4MS1B 5ITVA 1KBQA 4K7JA 2OV1A 1WHSA 4JLPA 1PEDA 5GGXA 1LC3A 1U0RA 3GA5A 4GI3A 4JLVA 4ENTA 3FE2A 2RI0A 3O0TA 4JKIA 2D1TA 1EWKA 1GILA 1W47A 3AUFA 4IZIA 2PT5A 4HLUC 3FUUA 4RSGA 3GA0A 4D98A 3Q3EA 1QYWA 4BTVA 3N86A 3CKKA 4D3FA 1JN0A 1XDZA 2H11A 1ZGZA 2W9XA 5BW5A 3UHJA 4FE4A 4M99A 4ZOEA 2O2ZA 2Z8XA 4R0VA 2YRWA 5CDTA 2WKQA 4EGQA 1KI4A 2VDKB 4CTNA 1IPFA 1GPJA 2FK8A 1XCGB 3TKAA 3U4AA 3WJ1A 2XGSA 3AO0B 1E3WB 3E9QA 4ZKDA 1DTEA 4EG4A 2YW2A 2WLSA 4G9EA 2FJ0A 3H4MA 4LRUA 5DP2A 1SU8A 3RGWS 2I3BA 2IP2A 3TRDA 2ZOSA 3O21A 4LCBA 1OFIA 1Z7GA 4ODIA 2HREA 4NMXB 1RAIA 1C8KA 4PCVA 1YMVA 3VR4A 2B3TA 1BS1A 1FUYB 1R0BA 2PT7A 1HGXA 1B8OA 2FFQA 3T52A 1YRYE 5EIBD 1DKOA 1Q7CA 1TYEB 2Q4BA 2B4RO 3K9LA 3N8DA 4HX2A 2WSSA 4ZV4A 4ZRNA 4RFSB 1DCTA 5J2TA 5ECWA 4F0JA 1T2AA 2DC1A 4L74A 4HRAA 5E7IA 1YR8A 2WIFA 2V3WA 1PU2A 4MR9B 2P9QA 4WTOA 2H0QA 5KSYA 4I0WB 4XD7A 5J2UA 1JKMA 5CMLA 3PX7A 4Q19A 3UWMA 4MPTA 1EBBA 3S40A 4DN6A 5ICSA 3JQ9C 2VH2A 2YOHA 2Z6QA 3N74A 1VKRA 3LTEA 3PEUA 2XMRA 2YVQA 1DI0A 4NQZA 4OX9B 3HL4A 2AWOA 4GC9A 4EK9A 5FBZA 1UMCA 5I7FA 3RC8A 1DZ3A 2XRYA 3RVSA 1H0SA 4QFBA 1HDOA 5KYYB 1ZMBA 3GVHA 4HDMA 4I1PA 3IBYA 4ND8A 4QATA 4DGQA 3ZVKA 4ZANA 1N5DA 1UXHA 3R7LA 2VRBA 2J87A 1YS7A 3IO3A 4TWJA 3K20A 4B0PA 5L4LA 1H42A 1PT8A 2CL0X 1NZJA 3MJSA 1ZXLA 5CJPA 5DBOA 3V8EA 3SBOA 1IONA 1O8BA 4G8BA 1WB6A 1FOEB 3GPBA 4MQMA 4C7VA 1I7PA 1SIOA 3UMFA 4EA7A 4RZSA 1JQBA 1FDTA 2JIMA 3H9BA 5KCMA 4J3NA 1P9RA 4YRSA 5TGDA 1ZLXA 2G28A 3VJKA 4EG7A 4KLCA 3BMQB 4PC7A 3LECA 3TEJA 5B57C 2R7LA 3DE4X 4PSUA 1KI8A 1GLGA 2BFBA 3DSRA 3NHAA 3SLRA 1R8QA 1ZUWA 3RTEA 3SC2A 3EX7C 4CMHA 3VYVA 1KFBB 3SSMA 4K1XA 3DP7A 5E8JA 1LXCA 4AG6A 3QVVA 3Q5EA 1ZM9A 3K9QO 5GTDA 2JAWA 3D8UA 3E3MA 1O77A 4YT2A 2PTGA 1YZTA 1HF3A 1N6HA 5DN9A 5F1PA 5JCPA 5C7YA 3REQA 4LC0A 1PWYE 4AURA 5EEGA 3SIXA 1VKOA 3DO8A 1OFUA 5FADA 4JV5B 3NHZA 1YR9A 3BH6A 3CIFA 3SJZA 3UMGA 4E2FA 3ZCVA 3F5FA 4XOIA 3OZBA 3TTYA 2YKGA 4C76A 5GZ1A 4KYIB 4YYZA 3MQ4A 2IHJA 2KI5A 3GFOA 3QFSA 4M22A 4JQSA 4OUDA 5ALHA 3RYFA 2C99A 1Z2OX 4RHTA 4U9UA 2Q4TA 3VPFA 4DJDC 1PG5A 2ICAA 5JSHA 3QWBA 2IY8A 3Q8MA 3PGKA 4IXTA 4BJ6A 4EZEA 2JIDA 3P9PA 5DK4A 1ZNQO 4A0RA 1JG3A 1K5GA 3OZDA 1ZICA 1Z3IX 2D4AA 2VI5A 2ZJ2A 2FSVC 1LLDA 5ILQA 3ZHYA 4CW7A 5JMTA 2O6LA 4XVRA 1O94D 1C9JA 3L1IA 1WA5A 7MDHA 2ZQZA 4XE5A 4KSCA 4D7AA 1IN6A 4FFLA 2GKGA 5AOCA 3UJ9A 4CM1A 2G9QA 4KFSA 5AFSA 3AF6A 1TJYA 2RI1A 1SWWA 1IJFA 2WB4A 1F0YA 2ADOA 2JI8A 3EVAA 3UB4A 1S3SA 4PINA 2GHIA 3VNRA 5AVVA 3GLSA 4C30A 2M2IA 1CP3A 3MERA 3SZUA 4N4AA 5MN6A 8MHTA 4F92B 2R6HA 2M1XA 1T5BA 3GLHB 4GH5A 4DY6A 1B41A 1E2UA 1TA4A 4Q3KA 2BZ0A 1N25A 4AYTA 5EWLB 2XRFA 2C9BA 1IN1A 1RBZA 4GC5A 4UPDA 3KJIA 4QBFA 2XKAA 3A4YA 1DIBA 3IODA 2A9JA 1NV8A 3WMEA 1EH5A 5DOVA 2RK6A 1SHUX 2W2MA 4QGFA 1A9OA 1I3CA 1GKYA 1D1SA 1JKJA 4DV6B 1FP4A 2HBZA 1XNGA 4PR0A 2X0KA 2ZTMA 2WJAA 3ZOKA 1ZIXA 4JYZA 4AJIA 5EMLA 3OFND 1F8GA 3IMCA 3H8WA 4MPJA 3D6AA 3FZQA 4OBBA 4EL5A 4HH1A 2NO0A 3KHKA 1WU8A 3MTJA 5G41A 4C1BA 1MJFA 1Y6JA 3E5MA 3DUWA 3SQWA 3OTHA 1UMBA 2CNNA 3PGA1 4UTZA 5LDHA 3WHKA 1UWCA 2M98A 2ZBDA 1Z2EA 3WL3A 2VOJA 4GM4A 5E1BA 3W2EA 1KY3A 1VIVA 3OOSA 4J3JA 4DLAA 4UZEA 4EY5A 3KV3O 3H5RA 3CV3A 5EVCA 5FA5A 5J5VA 4TZKA 3PITA 3K0BA 1GZDA 2GEBA 2VDQB 4HNHA 3BRSA 4RIGA 3UMSA 1HDXA 4LEIA 5FNVF 3RG8A 5IT4A 3RV4A 2WIDA 1DP4A 1OHHA 3DMTA 4GE3A 4WECA 2CMFA 5AJUA 2X77A 4RELA 4DG5A 2YDYA 4CT5A 2OFOA 4LXQA 4OB6A 3E3AA 1C1DA 5KYXA 1BXRA 5FEUA 2FQXA 3LFHA 4D81A 4CMKA 2CVQA 4RK5A 1U0EA 1XSEA 4RHUA 1GL3A 1ZUD1 4KI0A 5CYGA 4B3MB 1JPNA 2YJTD 4TN1A 1N5OX 4EGSA 2ZTVA 1YB7A 1K89A 2OLEA 3DLTA 3LP6A 4IDHA 5AYVA 3HU2A 3SF8A 3ISTA 4A1OA 3J81k 1VHTA 3LNTA 1I8TA 3O1LA 1L8OA 2JGDA 4L0CA 4QXMA 1G4UR 1SUDA 3PNQA 2GCEA 3SNHA 2A92A 4FIDA 3EXG1 4OHOA 5AI8A 3H6GA 2OTCA 13PKA 1DOHA 3FLMA 5I9BA 4Q47A 4RPCA 3SHWA 4QU0A 1K2WA 1WCIB 3ENQA 4LXUA 3WLLA 2FWIA 4CXMA 1J6UA 2ECFA 1ZMTA 2CMHA 4DNOA 4D4JA 2KBFA 2HSJA 2WZDA 2BKUA 3K2EA 4OM7A 5G1PA 2WW8A 1M1YA 4Y6GB 5ALRA 3UOGA 3PTLA 3RHZA 1G20A 2VDJA 4ZHQA 2YXPX 3AVOA 4IIXA 1OVGA 2DPYA 1G38A 4TKUA 3O31A 1ISJA 2CGEA 2FN3A 3L4JA 4MI6A 1M1YB 3AEQB 2VNKA 3AP3A 3QOYA 4G3XA 4URXR 5AW5A 3SQXA 2J0VA 4EMBA 5MGNA 5JYEA 2FZ4A 4AKIA 3CCCA 2WUWE 4KVAA 1DEOA 1F60A 1R5JA 2LGJA 4M46A 4N39A 5CNIA 3E05A 5IJ9A 3QZUA 1DAKA 2BUBA 4BKRA 4KDEA 3KPWA 2I6FA 4A8JB 3OT5A 4KNVA 4P33A 1QYDA 5A62A 4MRMB 4AKHA 3MBKA 4P4UA 1PS9A 1UC8A 3INNA 4ENPA 1NBWB 2WHXA 1E6CA 4GD3Q 2OBLA 3ZK8A 3OWXA 4GVLA 3OURA 4HTFB 2B61A 3C3CA 3JY6A 1DJMA 1Z36A 2Y3IA 4W99A 3LLVA 3VKGA 2Y1DA 2D8AA 4UFPA 4OI0A 1E79A 2C31A 3J7TA 4AO7A 4YGYA 1IBCA 2V4MA 1DDOA 4ALJA 3AJ8A 1M0EA 2G67A 3DE3X 4D44A 5LC1A 3IBCA 1ZXXA 3KYJB 5T8KC 3VTFA 4ID9A 1WBBA 3T3OA 3IJEB 4MROA 5F7XA 1HT0A 1C3OA 2PX0A 3G8DA 3L1JA 4QFMA 2MINA 3HMQA 1E6MA 2GPAA 4S1TA 4HLUA 2EJUA 3IKJA 4OI4A 4M1EA 4HDSA 3DMNA 2HW8A 3K0FA 3RKSA 4MV7A 3B51X 1O0CA 3A9SA 4HEA6 4W5TA 1DV2A 4B79A 1GUZA 3GY0A 4DCTA 3TNDA 4PSAA 4TM7A 4C0AC 1MH1A 2HCFA 1PJZA 1QBGA 4MX8A 5AQEA 2AJBA 3MCUA 4R0NA 1NVWQ 4ER7A 3CLVA 5TARA 5FYDA 4MR8B 1QUEA 2C2GA 5AJWA 1QF6A 1BYIA 4XD7D 4R81A 4Z9YA 3TTTA 1R9MA 4FILA 4TSFA 4QUIA 3IILA 3FBTA 3FETA 1L1EA 1Y4AE 4YJDA 4L0DA 3VR5A 1YVUA 2CNWA 1WBJB 2KHZA 3BE4A 1EUZA 3C7CB 3FGOA 3RRJA 2QX9A 4MS4A 1XRPA 1ZDMA 3G1UA 4IDCA 2PJZA 4UFOA 4CLDA 4EA6A 2GCOA 3F8TA 1OXTA 2Q2QA 1HZZA 4JEHA 3T38A 2ISQA 2AB0A 1U2RA 5ENVA 4FMDB 1MV5A 2P5SA 3ZDYB 3K9BA 3ROKA 5JQGF 1ILEA 1ZM4A 3U56A 3GGPA 3HPQA 4HYQA 3BMOB 4J16C 4JB8A 1X1CA 3GBPA 3FFWA 4KP7A 1KDZA 4YK7A 1DEHA 3ZKWB 4EW2A 2Q41A 4A03A 4J6FA 1GQ2A 1ZWLA 3L0IB 3QOWA 3UAVA 4BNYA 5LVAA 1NQTA 4ZAWA 5AVSA 3K72B 5F4BA 1JH8A 1L4NA 1TFUA 3HR4A 3K09A 3HI4A 3FCEA 4PC1A 3MPOA 3LXUX 3NKFA 4FDTA 3EGXA 3L9XA 1E9AA 2OVBA 2VJPA 2WJGA 2Y93A 3V32A 3ZNQA 4Z4QA 3TQCA 4R83A 4ZXPA 2B9VA 1GG5A 1NY6A 3FMFA 5EMJA 3MJRA 1FDRA 3TRKA 4KZKA 5LQDA 3I6ZA 4TL8A 3KHUA 1MJHA 1SUFA 2AX4A 2NXWA 1THGA 1VP9A 3C5WP 4P2BA 4CR6A 2OCKA 2OEPA 4FBMA 2O2HA 5DV9A 3NBAA 3SVTA 5CBKA 2VSFA 4MW7A 4N41A 4DZZA 5IKMA 2ECQA 1N2CB 2P9BA 4MPPA 1RYYA 2YC4C 4Q1EA 4QSHA 5FO1A 4EA9A 5DBGA 2ZJ5A 3PNOA 4L9RA 2ID9A 4PV7A 2NNWB 1I1OA 1X9IA 2PIDA 4AJ4A 3D8RA 4ESHA 1Z0AA 3C8DA 4OFXA 3VKWA 4C88A 5HBRA 5AR1A 3CUSA 1E3IA 1P0IA 4Z99A 4G4SO 2DSNA 3V55A 1LB1B 1ISSA 2BEVA 1UZLA 5DHUA 4F86A 3GHHA 1LGYA 2PK3A 4IEEA 4LG1A 4B47A 3MJCA 5LWQA 3HJFA 3U4CA 3PDJA 2IY7A 2WZBA 2NYVA 3IRVA 4BQEA 4CM4A 3HBAA 3V4VB 4ZICA 3RIGA 4UBOA 1PVVA 2PZBA 3ABRB 3UZUA 1YDFA 4KRYA 1OIXA 3KRTA 4RF2A 2ZSFA 1GU1A 2RJOA 4IJKA 3OZTA 3ETEA 3RIMA 1BW9B 2EBWA 4DLLA 4KIGA 5A3QA 3I62A 4OY3A 3ZW8A 1WXQA 1Y3IA 1IOZA 4FYJA 3W2TA 5DSXA 5FQNA 3X1ZA 5BUQA 1S5PA 4OXQA 1RDFA 2FUEA 3WWCA 5F52A 2FW6A 3UQZA 1ATZA 4Q9JA 3NH6A 3OCWA 3HJBA 4DUGD 4W6QA 4ND8B 1L7OA 4XX0B 3RC3A 2ODBA 5AI6A 5C1PA 2C03A 3KNZA 1CB0A 2WSYB 3C3MA 4TVBA 4ND2A 2O3UA 4EI7A 3RLIA 4WN3A 4Z7OB 3WYEA 5IT0A 5JRZA 2EKLA 3BK1A 4AVYA 4P0TA 5KHAA 1E1KA 2WIGA 5JVDF 1DO2A 4BU1A 1NNUA 1T0HB 3BF8A 4F1KA 4MVWA 3O8BA 3I64A 2W42A 1GRCA 2NUBA 3DZBA 5IZ4A 2GDZA 3DCNA 1D0IA 1THZA 4K2HA 1FS4A 2PH7A 3M5CA 4UHBA 5BV8A 5K45A 4ASUD 5J2UB 3HB7A 4M49A 2YWCA 2WICA 4I3HA 3WADA 1E77A 2Q2VA 1O89A 4WFIA 5E7QA 4XCXA 3V46A 2CXTA 1CR2A 1TNDA 7ABPA