6CHYA

Structure of chemotaxis protein chey
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHEY
publication title Crystal structures of CheY mutants Y106W and T87I/Y106W. CheY activation correlates with movement of residue 106.
pubmed doi rcsb
source organism Escherichia coli k12
molecule tags Signal transduction protein
total genus 46
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 1996-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 6chyA00
3FDFA 3JTEA 4XAQA 4G0MA 2CHFA 2FQYA 1Z25A 2L17A 5EWJB 2CD7A 2JVIA 2GWRA 1CEYA 2OQRA 1E6KA 5DTEA 3Q7RA 1GUBA 4MGEA 1Z17A 2IPLA 1JFVA 4LRQA 5CNKA 3QELB 3S99A 1BDIA 4DQDA 1QQAA 5GQSA 3GV0A 5TQJA 3KLNA 3JY6A 3Q7TA 1ZGZA 4MPTA 4RU1A 1XHEA 5B3JC 5KQLA 3H6GA 4MYRA 1LBIA 1C0EA 3HSYA 1Z12A 2GI4A 3LUKA 3HO1A 4MQFA 5DLEA 1NY5A 1K68A 1QKKA 2MYPA 3O2SB 3KJXA 2IPAB 3QLVC 1Y1LA 1DCFA 1JH9A 4RKRA 4Y9TA 1Z16A 4UHKA 3HM9A 4MR8B 1LBHA 4NV3A 5HM6A 3RH0A 4ETNA 3LUCA 2RDMA 5T7BA 2VUIB 4Z4FA 1PNRA 5CNIA 3CZCA 2QSJA 4EYOA 3HVRA 2L18A 3CS3A 2OENG 3FFWA 3QEMB 4NCAA 1ZY2A 3CLKA 3LUDA 5D2CA 1ZHHA 3KS9A 4RK1A 4ETMA 5KWSA 2JBAA 4YO7A 2F8TA 3LUJA 4O5AA 4Z9AA 1W9HA 3LFTA 1GLGA 4RKQA 3RVPA 5JNTA 2F8SA 5C5EA 4XXHA 3DGFC 1BA2A 3A0RB 2NZUG 3RVLA 4JB2A 2MYUA 4N0QA 3CKMA 1YIOA 2J48A 4G86A 3QEKA 3RVJA 3OM0A 2MSLA 1TM2A 4M88A 4N76A 3A0UA 3IP7A 4MS4A 4EYQA 2ZAYA 4HYEA 2PLNA 4LDZA 4MR9B 3NNDA 1QO0D 3MMNA 3OLZA 4YS6A 1JWLA 4MQEA 3O2JA 1JYFA 4NICA 4YGXB 3SAJA 1DZ3A 2NT4A 3HUTA 4WWHA 1W25A 1T34A 5IUKC 3H5OA 1DBWA 4OLAA 1KGSA 3JS5A 5EWMB 1F51E 4RDCA 5C5CA 4RXTA 1NXVA 4NCBA 2BGGA 5IUNC 5DCLA 1TVMA 4H60A 4KFCA 4OLBA 1U0SY 3O2QB 3URMA 5KQMA 3OMWA 4IF4A 1U8TA 3OO1A 4KV7A 4HNRA 2PUGA 4RY0A 1D1PA 2M98A 3KKEA 4G0OA 4HNQA 1RZRA 2R4QA 3DLHA 5DKFA 3RVKA 5JNWA 3KYJB 1A0OA 1MIHA 4W5NA 4Z4GA 1KRXA 4B09A 4ZMRA 4Z4IA 3NNSA 1D2AA 2FMFA 3KG2A 3MA0A 2I6FA 2LIVA 2WJWA 3QLUC 4YV7A 1QP4A 1Z18A 4G0ZA 2Q5CA 2H3HA 2CWDA 5BQ3A 2HQOA 5KC8A 1RXEA 4MS1A 4TMYA 4JA2A 4TLLB 4N41A 3CNBA 3D02A 3UKJA 1BDJA 4LE2A 2YHBA 2A9QA 3LKBA 4MRMB 5EWJA 2VK2A 4XFKA 1FFSA 3BBLA 1YS7A 4EVSA 3HS3A 3QX9A 1NXPA 4OG2A 3OQNA 5JNVA 1Z26A 4KNYA 1XWWA 2FMKA 1SXHA 2E4WA 1RPJA 4IRXA 4MS3B 1DBPA 3QELA 4JOQA 1PEAA 1USIA 1I3CA 1P6UA 4RK7A 5JNRA 1R8JA 4P1ZA 4FE7A 2PUCA 1ISSA 3CG4A 2M1ZA 5IEJA 3QX8A 5ABPA 4KRFA 3KTOA 1PEYA 2E4YA 1MB3A 1GCAA 3EJWA 3LUFA 4EVRA 1JFSA 1U04A 2YHAA 2V0NA 4ML3A 2FEWB 3Q41A 3CU5A 1AB6A 5JS2A 4IMIB 3L49A 7ABPA 2E4ZA 3CTPA 3I09A 3ILYA 3P9YA 1MVOA 1IIBA 2HJ9A 2QR3A 1ISRA 3C3MA 4N0PA 3TMYA 3W9SA 1HEYA 1LJUA 4QPJC 3GYBA 3IP6A 2PUFA 2RJOA 3G85A 3OMXA 3QEMA 1WETA 2ZWMA 4OATA 4WXEA 2GKGA 1BAPA 2IPMA 4YCSA 1YMVA 3EULA 6CHYA 4RZSA 2IDMA 2JVKA 3N53A 5B3JA 2FKAA 2VUHB 2FW0A 2W42A 3H1FA 1PNTA 3EQ2A 1JFTA 3C3KA 3RVQA 3H1EA 3H5LA 2NZVG 2PAFA 1DC7A 2LPMA 4DADA 5KI6A 5I4CA 3QLVA 1JYEA 3N0RA 3GBVA 4KMRA 4TLMB 2IKSA 4JB0A 3L6UA 4XARA 1QQBA 2A9PA 1TLFA 2MYTA 1BVHA 4Z99A 1GUDA 5EWLA 1OXBB 2QZJA 1ZITA 1DP4A 1D5WA 1NXOA 2PMCA 5HQJA 5BR1A 3DBIA 3HCWA 5IBQA 3B2NA 4MR9A 3IP9A 3OLYA 1Z2EA 1NXSA 2PL9A 4D6XA 5JNUA 5JS1A 3C97A 3H5IA 3ILHA 4L85A 1FSPA 1ZAYA 3I42A 5FWXA 2FEKA 2QXYA 3H5VA 4O1IA 5TE9A 5IUJC 4RK5A 3UUGA 5EWMA 1DG9A 1L5ZA 2PUAA 3MQ4A 1M2EA 2WRZA 1QP7A 3BREA 6ABPA 2P4UA 1BDHA 5CNMA 2NUBA 1EWTA 3HUUA 3SY8A 2QVCA 1YK0A 2L19A 3HV2A 3NNNA 1SXIA 3OLVA 1XHFA 3F7NA 4GNRA 4IILA 3SM9A 1APBA 1QNLA 5ED4A 4KZKA 3H75A 3OM1A 4S04A 4FE4A 3GA5A 4LZLA 1M5TA 3RQIA 1DC8A 4G97A 1CYEA 2FEPA 3UK0A 4KQCA 1FFGA 2GBPA 2GX6A 3GBPA 3O1JC 2FN8A 3T8YA 4ZYLA 2QU7A 3RVOA 1VRVA 5TPWA 3KLOA 4Q6BA 2PUBA 2CHEA 2LP4Y 2JBAB 3LTEA 3M9XA 5FWYB 1AB5A 1DRJA 3LKVA 2HPHA 5TQ2A 1RNLA 1E6LA 1JDPA 2E4XA 5IULC 4Z9BA 1F4VA 1P8AA 1DBQA 3DZDA 2NT3A 2QV0A 4Z0NA 4MRMA 3GL9A 3CRNA 4E7PA 1ZH2A 3TX6A 3ROTA 1Z2DA 2JK1A 4JAVC 4Q7EA 3LUGA 3IPCA 2X7XA 3F6CA 9ABPA 3BRSA 4MS4B 5FBHA 1TMYA 4LDAA 2N9UA 4JP1A 1YTUA 1DRKA 3N0WA 1A04A 4H3HB 2JCGA 4MQEB 4Z4EA 3CZ5A 2XDYA 3IP5A 1L5YA 2JVJA 3QLUA 3LMKA 4F12A 1YMUA 3N0XA 1PUXA 5T3YA 1UDRA 4D6YA 3GWGA 3MYYA 3T95A 1OXKB 2B1JA 3R0JA 5TPZD 2O20A 1SD5A 3HEBA 4H3KB 3LUAA 4PEVA 1JDNA 1ABEA 4YWHA 2LBPA 2L2QA 4L4UA 4PYRA 2PJUA 4YR7A 2IYNA 3HDGA 1M2FA 3EODA 2RGYA 1KRWA 2IPNA 4ZPJA 2HQRA 4PE5B 3EQZA 4RY8A 4XASA 5KC9A 2FQWA 3CG0A 4EGSA 4W5TA 2FXIA 2B4AA 4KVFA 3NBMA 3FMVA 4O1HA 2WWVD 3I5AA 5TQ0B 3O1HB 5PNTA 1DCKA 1JX6A 2FMIA 4RV5A 4MR8A 1CHNA 3I45A 3FFXA 3OLXA 3KCNA 1NXWA 4N03A 2FLKA 1NTRA 1QO0A 2WMYA 5BRAA 3T6KA 1TJYA 2WB4A 1U2QA 1QPZA 4MS1B 1FQWA 1SXGA 1PHRA 4E7OA 3NHZA 4WT7A 3KYIB 4KREA 1MAVA 5IX8A 4QICA 2HSGA 1U2PA 3H5TA 1M5UA 1VLZA 1ZGGA 4MR7B 3JPYA 3JVDA 4ZMSA 4D74A 3TO5A 5FBKA 1RZRD 3KSMA 4JASB 3FGZA 3TB6A 1JHZA 1FFWA 3CHYA 4TN5A 1JF8A 1USGA 1H9CA 2QVGA 2HQBA 3C3WA 4W5OA 2E4UA 3IPAA 1NATA 1RXIA 1JLKA 4MLDA 2FQXA 3N6VA 1URPA 2KYRA 1B00A 1YS6A 3RVMA 4YRZA 3KHTA 1YVUA 3QLTA 5GOTA 3DGEC 5KQPA 2LUOA 4RSMA 4RWEA 3N75A 2FN9A 2VYCA 4EY3A 3HXMA 3O74A 3IDOA 3K9CA 3M9WA 5CNJA 2AYZA 3T38A 2AYXA 4NQRA 3O75A 2MSKA 5HSGA 4QYWA 1ZH4A 4IMJB 3MIZA 4LE1A 4RXMA 5E3JA 5HKOA 4DN6A 3RVSA 3HDVA 4EYKA 4MQFB 2PL1A 4P98A 1EAYA 3FFTA 2P9HA 5KQGA 1NXTA 2PUDA 3JPWA 1D4ZA 5FWYA 1MB0A 1EFAA 4CBVA 4HNSA 1J56A 2DRIA 5TPZA 4Z4CA 3HK2A 4MAAA 2A9OA 1DCMA 3OLWA 4G0XA 3OQOA 1LK0A 1YK1A 2FLWA 1Z13A 3EDCA 3HZHA 3Q7SA 3QK7A 8ABPA 4YP9A 3GRCA 4RK6A 5EWLB 4ETIA 1LJLA 2ID9A 4WXMA 4WUTA 3EAFA 2WY2D 4OTZA 3NHMA 2ID7A 3EGCA 3CFYA 2E4VA 5DGCA 3SNKA 1USKA 1JL3A 1ZESA 4ZJPA 3BRQA 3G1WA 1P6QA 1QMPA 3DLBA 2PKXA 3F6PA 3VNBA 2R25B 1ZN2A 4RK0A 1VKRA 1EWKA 5FWXB 3D8UA 3H6HA 4Z4HA 4GPAA 4QYMA 1GCGA 1VPWA 1K66A 4IGAA 4OBBA 4KPYA 3SG0A 4LX8A 4F11A 1A2OA 2A9RA 4XLTA 4KK4A 4LE0A 2H0AA 3E3MA 3RVRA 2FMHA 2IOYA 4MS3A 1D1QA 2FTKE 1ZDMA 3E61A 3A3KA 4N47A 4F06A 1Z15A 3A10A 3LUHA 3MF4A 4KQ9A 1QP0A 2MYNA 2JB9A 1ABFA 1P2FA 3ROFA 4W5QA 2PUEA 4G0PA 4RK4A 4G0QA 3K4HA 4MLCA 2WJAA 1KMIY 3BILA 5IC5A 3RVNA 3HJFA 3H5WA 4PZ0A 2TMYA 5TQ0A 2PE5A 4PICA 3Q9SA 3H1GA 3OO0A 1E2BA 1EWVA 2RJNA 3GT7A 5TPWB 4F3TA 1EHCA 4KK3A 3VNAA 1DJMA 5IEBA 3JVIA 3O21A 4RS3A 2MSWA 3M6MD 5CHYA 5TQ2B 3TD9A 4EUKA 1S8NA 3F73A 1E6MA 5F64A 3O1IC 3SQNA 4Q6WA 3C6QA 4FB4A 4F8JA 4MR7A 4W5RA 4UHJA 4WZZA 2R47A 4S05A 2QW1A 3OQMA 1ZVVA 4EVQA 2R48A 5JNSA 1NXXA 2FSPA 3N8IA 1SRRA 4G0YA 3LOPA 1JBEA 3Q15C 2FVYA 4RY9A 1C4WA 3MM4A 4RXUA 4EYGA 4YLEA 2JRLA 5BRJA
chains in the Genus database with same CATH superfamily
3FDFA 4IDBA 4I55B 4U2KA 1X7ZA 4R1QA 4I4TA 2VHUA 5DHQA 4OJQA 4LJKA 1NNSA 1L7RA 4YJFB 5KZMB 5HKKD 1U2EA 1Y9DA 3ZTTA 4F9GA 4ZU1X 4BNFA 3DDNA 4H4DA 2FFJA 4LSGA 2E85A 2X8WA 3ZDZB 2C2WA 3DZHA 3E22A 1PL7A 2FWMX 3C70A 4DG8A 1V7QA 4HZGA 5AUPB 4N7RA 5DHTA 5KQLA 2V5VA 1RYFA 3DDZX 4HXEB 3HN6A 1C0EA 2IYWA 3EOAI 2FSSA 4UUOA 3CT4A 3GLFE 2YIMA 4L8LA 2G07A 1T2EA 4DLYA 1Z5GA 4O4JF 3VO9A 5E7QA 5DDIP 5CM2Z 4G1CA 1DC3A 2HCJB 4Q1VA 3UUEA 4WLEA 3IVCA 4Q34A 3UWDA 2YY6A 4KPEC 1P1CA 2CBGA 1PNRA 1NR7A 2CMGA 4AJLA 1FYVA 1JIIA 1KY5A 1ZMTA 1XMIA 2I80A 3TD6A 1UODA 4RLFA 3TRFA 4X64B 3MERA 3M33A 4GT1A 3TLEA 4E2ZA 5K0BA 3T1OA 1W0KA 3X1XA 4IAOA 3F97A 3AVWA 3PI7A 5AJTA 1QHXA 4DNPA 4M7PA 4OX9Y 2XITA 3B9PA 3H7AA 2F8TA 4KSYA 3FWZA 2VL7A 1GLGA 3OOEA 1BMTA 1HYEA 3NEJA 5B1DA 1PDOA 3JQEA 5DBEX 4Y2RA 2CYCA 4JBYA 1GPKA 2FSVA 2JFGA 1NKVA 1I51A 2QM0A 2XQVA 3ND5A 4LMPA 4TT3A 1O77A 5FTMA 3RD5A 1MR3F 1Q2XA 2B1GA 3JWPA 3WGLA 5IBCA 2XDQA 3K1TA 5BSEA 1AE1A 4LWOA 2FSUA 3GARA 1YI1A 4HB2A 1TM2A 5KYYB 3GG9A 2QYHA 5P21A 2Q7XA 1JEAA 1GPUA 1CVRA 1DPFA 1V3UA 5K0LA 2ZCJA 4DSTA 2P6PA 1EPUA 2W71A 1P0MA 2ZSJA 2NO7A 1SVNA 3GAZA 5IYZB 5C51B 1H1TA 1T34A 2XQKA 3B82A 3KXLA 5AYVA 2PRKA 5I4KA 7REQA 1FRNA 2JGMA 3ACCA 4KE8A 4MW6A 2EYUA 3FVWA 1FNCA 1S4MA 2XYRA 4GZ3A 4UU8A 3U4DA 4D9HA 1NXVA 5AI8A 5GV7A 3U9SA 1F8UA 4B3BA 4W63A 1AS0A 3BB4A 2GPAA 2OGZA 3KK0A 3UJCA 3X1KA 1CKEA 1FK8A 2FUCA 4KIFA 3QG1A 5TNXA 4CETA 1U0SY 2V45A 3D4NA 1WZIA 4EKGA 1OB2A 1UBUS 4TV9A 4CMGA 1QVAA 1VHWA 2P3OA 3BHIA 4O33A 1SBTA 3F9CA 2FRXA 1Y3BE 4FYMA 3VU9B 4QU8A 1VJ1A 2G0AA 2Z83A 4OB8A 1RWBA 3TGWA 1RLUA 5F2KA 1GZ4A 1Z0AA 4QO7A 4CFYA 3CWZA 2EP8A 3P0FA 4MUGA 1CJVC 1DRWA 3K0CC 4BVHA 3FIUA 3L7BA 5A5FA 1W5FA 3CR3C 3K5IA 2G1AA 3D8TA 4IIVA 4NVRA 1AX9A 2DP4E 5SY4A 5HIIA 1YR3A 3QUCA 4R98A 1QP4A 1Z18A 1IE3A 2VDLB 2H3HA 2DUWA 4PSCA 5DYIA 1RXEA 1GTZA 3EXFA 4D8WA 4TMYA 3HJAA 3SYTA 1PZXA 3H99A 3PC4A 4IDOA 4IHJF 4MARA 4F2PA 3AOGA 2DWOA 3AINA 3QVMA 3VMFA 5EWJA 1US8A 3WIVA 1EP1B 1U9ZA 4INOA 1VYHA 1XPJA 1G20A 3CLRC 1JXQA 2C0CA 2D1YA 4JLMA 1J0EA 2PU5A 4WW0A 3INRA 1FL9A 4GHWA 4AUNA 3DEFA 4M0MA 3IVRA 4NFYA 4ZCRA 5BOSB 1AF7A 1BX0A 5C31A 4W5WA 3ZH2A 3W05A 4Z1MA 2D62A 3I6MA 5HCNA 1R16A 1Z5WA 2I8LA 4B6FA 2YXNA 1H3EA 2XVMA 2MCFA 3TN7A 2O5VA 1O4VA 3PDCA 3FF1A 1J42A 5FADA 3GCDA 4DQUA 3PD1A 4HH4A 2PSDA 3BJZA 1T9ZA 1HX7A 4IGEA 2WTAA 3I09A 4HWGA 1HL7A 1MVOA 4R6XA 2C3UA 3EOZA 4GOLD 4HT3B 1HZJA 3W8RA 2HXGA 3GVIA 4F45A 1K06A 5B12A 4WUVA 1A2KC 4GPBA 4P3XA 5IJ0A 1RLOA 4MICA 3V97A 1OXTA 2B2NA 2BEWA 4LNUA 2C03A 4AECA 4AY5A 4LXHA 5EJ9A 2B8NA 4IDAA 1R1DA 3H9GA 4V0NA 1TIBA 2WU0A 3EXIB 4Y3UA 2P5TB 1FFYA 4EBFA 3GY0A 2CCKA 4F2HA 4JP8A 4OPMA 3I12A 2HSZA 2GH1A 1L7PA 2VHXA 4QE3A 1SXQA 2QBYA 4B3HA 1KI8A 1JYEA 1KDZA 1O96B 4BBJA 4NV1A 5HUJA 2WHXA 3U4GA 3GRUA 4Z99A 3U4IA 2D74A 1GGJA 4AF6A 1CE8B 2X7HA 3RRJA 2WWRA 4YRGA 3EGOA 4CIVA 1KYQA 2OILA 2H85A 4Y9UA 2BSXA 4YJ2A 1HNXB 1ST2A 4GAEA 3KL2A 1N5JA 1NF2A 1IHDA 4KODA 4KYTA 4A1FA 1FVXA 2X4IA 3L9WA 1PFWA 5FPQA 5IC6A 5B1YA 2HF9A 3H9CA 2C20A 2G40A 2INGX 1VE7A 5BP7A 1T2CA 2RI6A 4V0RA 1T6YA 2HJWA 3K0AB 1DAKA 4K6CA 4PXSA 4KYVA 4EB6A 2HMYB 2CLLB 3IT1A 1RZ3A 2WD9A 4JV5B 2RBKA 4ZQEA 1BE8A 1Q1ZA 2HC9A 3CUEF 3PNKA 1FNSA 3LZ6A 2QMEA 1APBA 3SM9A 1GZ6A 3NIBA 4F86A 1PLLA 3QVXA 1WP4A 2EERA 3L04A 2JFWA 4LJ7A 2O8CB 4IGKA 4C0AC 4J1TC 3DQZA 1PI3A 4LZLA 1C3VA 1SUFA 3V1NA 1FF9A 2H4XA 1CNEA 2DXIA 3A6JA 3AEKA 1JXAA 1FXWF 3W79A 1XNJA 1FFGA 1YNOA 2I3ZA 1PK8A 3SYNA 2COEA 4BNGA 4MINA 1JG2A 4C7KA 1QDLB 2UZIR 2HT1A 3M2PA 5HPYB 3O47A 2HT6A 2FUG6 3LU1A 2WHRA 3U7EB 2A9JA 2VT2A 3NW9A 4PLYA 2PGXA 1Q6ZA 4RVFA 1P17A 3TDKA 4DA7A 4Q3AA 2FRDC 4PPGA 2IYEA 1LI4A 2QXUA 4II7A 3Q8LA 1IPHA 2FRVA 3SQOA 1G291 4ZARA 1WM1A 2PDAA 1ZIOA 4DIDA 1M0EA 3AL0C 1CRWG 3I37X 3KQNA 1SC1A 5IULC 3AF0A 3GEGA 3U4QB 2ZIFA 1P8AA 4KYUA 3ZWMA 2NT3A 3CM0A 1IPEA 2ZIGA 4K26A 3GAFA 1XMOB 2ZIXB 1RAGA 3GU3A 3ZOZA 4BB5A 13PKA 3E84A 3F7MA 3OCCA 5J2UF 1TCVA 1NYQA 3IPCA 1G7TA 2IZOA 4XGNA 1XMSA 3DUFA 3ZNPA 4DLTA 2QE7A 4BEWA 1M8KA 2X41A 2YASA 1OIXA 1JU4A 1G3QA 5ECGC 4FQ7A 5EJEA 2ROQA 2JD2A 4MGYR 4MQEB 5A5VA 2FWIA 5DNEA 3TZHA 3C3BA 4HX5A 5JYBA 4WBNA 2IODA 3IKMB 4MWDA 5T3YA 1UDRA 2Z9BA 2FY8A 4P80A 4DBZA 5TIIA 1J2YA 2FP4B 4HWKA 2ZULA 2CSUA 2XA1A 3L4EA 5IDQA 4XVUA 1E66A 4RMIA 4EG0A 2V4UA 2DUUA 5C32A 4UHHA 1GZUA 4YJGA 3OBBA 1Y34E 3DLTA 3V4VB 4B17A 1ZJ5A 1UBEA 3GPCA 4QT4A 1BA3A 5JDIC 1EXDA 1NUSA 1Q1BA 2DFNA 2PMBA 3VR5A 5COBA 2EJWA 5A9TA 3QYAA 2BAGA 1FJGB 2EFEB 3KJZA 2K2QB 3EY4A 2FUG1 4IH1A 2ZUFA 1Z63A 1DQSA 4BNIA 2AI1A 1RQPA 3MS2A 3QEOA 4TZTA 2XZTA 1N2OA 1N7HA 2WAMA 3OJXA 3ZZNA 3SXPA 3T9CA 5IABA 3PGJA 3O4IA 4EHJA 1YRHA 3QXCA 3PQFA 3MCAA 4H59A 4I1OA 4XQ0A 2HW8A 1RWXA 2VRCD 1ZJ6A 5AJWA 4Q1DA 4RTRA 3A9TA 1CY2A 3LI2A 4LQDA 3ZBUA 2QZ9A 2WABA 3P45A 4DV2B 5JISA 3PUIA 4N40A 1H6BA 5AKLA 1ZISA 3KQYA 1Z39A 1GEEA 1H6CA 3KT3A 3O0TA 4L0DA 1UEXC 4M0EA 2JJ1D 4Y1FA 3S2FA 3TYXA 1PKEA 4DDVA 2I8AA 4GPTA 2IU4A 3IC5A 4JIMA 4QOSA 3D6AA 4FCVA 5F2NA 4PQRA 3ZVKA 2X8AA 1KYTA 4U2GA 2GXAA 3LXMA 1C9YA 1JF8A 4MV1A 1RU3A 3QVGA 1UQTA 4OSOA 4BO9A 4F3YA 2QP3A 1GNRA 1FDRA 2GZAA 5FOWA 2UU9B 3ZJYA 1WUKS 4ZT4A 1MORA 3H2GA 2DY0A 1P8JA 2ZDHA 3PL1A 4KNWA 4U6QA 1RXSA 1G5FA 3DEKA 4FHDA 4O2AA 1SQGA 5F3WB 1SG9A 4PLVA 2ZANA 4RQAA 1LRKA 2O0MA 4DC9A 4ZQFA 4QQRA 2EHJA 2BF4A 2EV9A 2GN9A 4JJ8A 4LYDA 4JEHA 4ER5A 3DE7X 3PDIA 4I5IA 4C6SA 2OO3A 1O6GA 5GWXA 3BIXA 3QJ5A 5AM2A 2OQ2A 3AX6A 2VAPA 1NUPA 4FVTA 1UXHA 2H11A 3TE6A 3IUPA 4RJJA 1CR2A 1TQDA 2R1UA 1BEEA 3IB3A 4D9GA 1GKYA 1NLYA 1T8PA 3DZFA 3H1BA 3UAWA 1WB9A 3P96A 2AXEA 1M6VB 1M9NA 3JPWA 5H81A 3L6CA 1L5OA 1P4RA 2CNLA 4M3NA 1NF9A 4YRPA 3H0CA 1XD2A 2GBGA 1V3QE 3CLTD 2BCJQ 5D00A 5AKEA 1H2FA 5COAA 4M1OA 2QUJA 4GSKA 5DT2A 3CNQS 4XSVA 5K2MA 2VWPA 3GRCA 4BV2A 3RK0A 4YUXA 1GNLA 4FNAA 1U8AA 4CIAA 1S3SA 1Z2OX 3W6NA 1OH5A 3E1KA 3WA6A 2EQAA 3ASYA 1M75A 2WIKA 3H2JA 1O6FA 2XRZA 1HOTA 4YREA 2FFQA 4MWZA 3KPWA 3B9RA 1E32A 3G1WA 4W7SA 1RRPA 1IHUA 2W43A 1RPAA 2QTWB 4Q9NA 5CPBA 4PZCA 4A10A 4ALNA 3GPBA 3PLNA 4L5AA 8MHTA 1W2HA 2VN8A 3H6HA 1XZBA 1C2TA 1UWKA 3RUPA 2RJ3A 4TLCA 4R8LA 1WVIA 5BMVB 1V9SA 5KYUA 3UWMA 5JC1A 1CW2B 3IS3A 3NCTA 1DLIA 3OTWA 3B5IA 4A8PA 1NQXA 3GA0A 4UU7A 1NULA 2D1FA 1GUYA 1UKAA 1X1EA 3AC0A 3F8TA 1Y5NA 4KPUB 4N47A 2NTJA 2XMDA 3N6RA 3LPCA 4MRVA 3T3PB 3SYRA 3MT8A 3PYLA 3USES 3PQ2A 4LS3A 2P2NA 3D0QA 4EHFA 1QP0A 1G8AA 3BERA 5A5EA 2GUWA 1A71A 1NRXA 1FDUA 1PR1A 1VCIA 1W0KD 2C5SA 2RHJA 4M1ZA 3ZKWA 5EUCA 4DWVA 3ND9A 1K3UB 2AXNA 5TS2A 4Z2AA 3E6AA 4R1MA 1QLHA 3GVPA 1A76A 1U0OC 2HA5A 2PBZA 1VE9A 4OFXA 3WKEA 3NLLA 1Y48E 1A5SB 2BEJA 4FOOA 4KO3S 2E2WA 2K4MA 4KIUA 3H87A 4NECA 5TXGA 5C1BA 1YUBA 4OO3A 4YCNA 3CUTA 1GTRA 1AIPA 4M9XA 2Y76A 3TECE 2K7FA 3CMCO 2E7ZA 4NEGA 1XRRA 5IJXA 4B87A 4PC1A 4A2WA 1OU0A 4E33A 5AMXA 3CZQA 2VZ9A 1OAOA 3C6QA 4TWAA 1G5PA 2ZRFA 1LVUA 2X0EA 1X87A 1TC1A 3ICQB 3NJ8A 1ODIA 1QH8B 1RHJA 2O6HA 3VSDA 2VTBB 3LH5A 5J5VA 2HCRA 2I2AA 2R48A 2H2WA 1DJQA 3H16A 5SICE 1WEHA 4YAFA 2YICA 1U5CA 1JKFA 2L42A 2VKQA 1WMBA 3BGSA 4JJ6A 3FUTA 4MUHA 1E1RD 5E6UA 2OFOA 3QBVA 3IYLW 2GYYA 1PGJA 1TVKA 1WUHS 3D8SA 3E70C 3HYCA 5IT4A 2X86A 3CN7A 3SFVA 1YZLA 3OZVA 2HQSA 3G23A 4CEIA 2B94A 3A36A 1Q91A 2FQYA 4ERXA 1YHZA 4PLPA 2GWRA 5A3VA 3RYIB 2UZ3A 1CLUA 4AICA 3C4JA 3CNHA 1BMFA 3T5MA 2KS6A 1OLXA 3KOUA 3UWPA 5JH7B 4PZYA 4EY8A 2YC2C 4LRQA 1W88A 3RRNA 1NJ2A 5KJFA 3KJEA 3PF9A 4MKXA 3QV2A 5BQ5A 3K1ZA 4UM9B 5KOIA 2QRMA 5T6BA 4MI6A 1LBIA 3WTCA 2ZRHA 3K92A 5ALEA 1LDGA 2E1PA 2HIHA 2NLOA 3EASA 1K68A 3DR3A 3HHPA 3JASB 4P8RA 1U99A 4CKZA 3L0SA 1GLNA 2YC4C 3C6YA 3OBIA 2XJ4A 4YRLA 1JH9A 2EU8A 1MV5A 1QK5A 2RH5A 4X90A 3VC1A 5C8YF 2VRNA 4ZKEA 3KTDA 4HI0E 4JD5A 4XD7A 4BP8A 4HNAB 4F21A 3ODGA 8GPBA 1Q83A 2XD9A 4NJEA 2GNAA 3DVQX 4TV9F 4N5HX 1KKLA 4FOTA 1UADA 1Y9EA 2XSZA 2WF6A 1ZY2A 3HKDA 1DSSG 3ZGXA 4XUEA 4NNJA 3IJ5A 4AZ3B 4EA8A 5DSTA 2IY9A 4MI1A 4B3FX 5KX5A 5KAMA 5T8KC 4KNVA 4IVRA 4L76A 3EMDA 2IH2A 1NONA 2QWXA 4R81A 4UDOA 2JIDA 1F2TA 1T2NA 4LJ6A 3A4YA 4HS4A 4Q4HB 4PQGA 5DMXA 3THXB 3IO5A 1A8QA 1QYIA 3OHSX 3SLGA 4AQYB 3KEOA 1Z9BA 3DGFC 4FGZA 3SQWA 1Y8AA 3HBNA 3L46A 3DPUA 4OCZA 1TYBE 2B69A 4UVHA 4XIJA 4OVKA 5TLSA 4UOZA 4AUKA 1XK6A 2B61A 2C7VA 2AKYA 2B4YA 2NZWA 2O7VA 2I91A 2V3WA 3E2IA 4MV4A 3ZR4B 3LVFO 4FMCF 4P08A 3G17A 3JR3A 2ZE7A 5JQGF 1Z2PX 3LRXA 1AKWA 3OLZA 1JMYA 3GW8A 5B7PA 3L5OA 5C34B 2F3PA 3OC0A 4GX0A 2FZCA 3REFA 4MLPA 2CUKA 3C5HA 1GAQA 1KZ4A 3TI7A 4DLNA 3E5NA 2YHSA 4IG9A 5AW6A 4TKMA 5CH3A 1VIAA 3ESDA 3ZLUA 3U13A 2GKSA 1MP0A 2VCHA 3S1LA 1TMOA 2H2DA 3VYUB 4AY6A 4ZAZA 1MC1A 4OFZA 3EGXB 2P2ZA 1O95A 5EVJA 5IDYA 4CMCA 2X9GA 1X7WB 3NVAA 5F4ZA 3I61A 4BBPA 4KFCA 1YE5A 3KSZO 1BXGA 4XLZA 3IMCA 3TW8B 4OLBA 2VUUA 3EC7A 5EKXA 3G2QA 3ND6A 4MA0A 3LDFA 2D1RA 2QD4A 3QVKA 3EA4A 3KJQA 4FD2A 2VK4A 4RSRA 4JFRA 1DC5A 4XD2A 3Q5DA 2YIJA 4ZQBA 3F90A 5C4MA 1MIHA 1RYMA 5I5EA 3G3EA 2B78A 4PR3A 3RYHA 4ZMRA 3OPYB 2BH2A 1HO3A 4U9HS 2Y1CA 1QJ4A 3TE7A 3KG2A 1VKOA 2C54A 4EFMA 4YRIA 2I4LA 4RVCA 3OC6A 1QIEA 2GEVA 5G0SA 4JQZA 2M6SA 4MVJA 2HWKA 1RT9A 3FJOA 1MH1A 4J07A 2JAWA 1WUJS 4YV7A 2PX6A 2Q6VA 4BQFA 4NBLA 2E3JA 2NO4A 3DD5A 3SJ7A 1DV2A 1V1JA 2CWDA 3H13A 1DB3A 2RBEA 3IH5A 4JLBA 5EMKA 4AZWA 2ZUDA 2CLEB 3AW8A 5L3ZA 3OLCX 5LQMA 1UMBA 2VTVA 1SNYA 5LMNB 2BDUA 1DRVA 1T4CA 4K8OA 4ND8A 3G9QA 5ELXA 1SUPA 1U90A 1YRAA 3UMGA 4DSAA 4FP9A 3WLQA 1ZD9A 4K9LA 1Z5PA 3L6DA 4YUWA 1JTFA 4R1NA 4G9EA 1CHDA 4DLUA 1RWWA 2I33A 4MRSA 4CHGA 2YJ3A 3E4CA 4PIPA 4K6GA 3H5NA 1K2WA 3T3IA 2J0QA 1XCBA 1WPXA 1JTEA 4WKBA 4DCNA 4GOOD 1FYWA 2P9CA 1GZHB 3BCUA 1F0NA 3IMEA 1FX0A 2XOEA 4JGIA 1TL7C 1GG2A 1BH6A 5K4HA 1M54A 2X0NA 2M1ZA 1FNNA 3PCXA 4OD0A 1EB9A 1MIOB 3CXUA 3KOMA 3OKFA 1F20A 3MOIA 3PEFA 3MINA 1C1DA 1SM4A 1LQUA 4CR8A 1NQUA 4I1VA 4KRXA 2Q1XA 5LZ9A 3KUUA 4DRZA 1NYLA 2CN1A 4OLJA 4KXXA 4AJNA 4ENQA 3F1KA 4OMFG 1N4AA 4DHEA 3ILYA 4WVFA 3FW1A 3TTUA 2ZW9A 2ZT6A 1LJUA 2VBFA 5JADA 5DK4A 2ZRGA 1I7NA 5FA6A 1XPOA 5DLDA 3PFWO 5FI0B 2GKGA 4YTEA 4WESA 5DASA 4DXHA 1HURA 3JSAA 2QE7D 5DOVA 3UJBA 2C2XA 2C9CA 2IDMA 1HC7A 2UYGA 1WUTA 1PL6A 2P9TA 3H1FA 1CDZA 5BQOA 4G8JA 4GDMA 3WP0A 5JO0A 1E1YA 1Z6XA 1W85A 1E59A 1A9RA 3GJZA 4J9VA 2MMCA 4PINA 2VQDA 3VPXA 4AZ0B 5JXIA 3WE7A 1NP3A 5KJEA 4FGWA 2JJQA 1T8TA 3N0RA 4RCVA 3AUXA 4BZZA 4DLWA 2PQMA 2I6GA 2J9YB 5K8CA 4FGSA 3GEPA 4DYDA 1CY4A 3DCYA 8ATCA 4JJZA 1D7OA 4PO9A 1D5WA 4ZOAA 2BC9A 3O0DA 1Z4QA 3JQFA 4AN0A 1SUIA 1ZBDA 4HUQB 1JG7A 1NXSA 1YL5A 4P86A 2GESA 5E9JA 4BLSA 2D00A 3ACDA 3FPGA 2IELA 3MGKA 4FEAA 3L43A 3CEAA 4N3AA 1GTG1 2EKBA 3AFIA 3FUUA 3OIWA 3PNBA 2RGNC 5TE9A 1L1FA 2ZQYA 5HW0A 2DHEA 2GFQA 3JCZA 4QXQA 4JITA 3MQ4A 1V25A 5AVSA 5NULA 4P32A 3QVUA 3R5KA 1L0BA 4N01A 4US1R 2B7LA 1QB8A 3PEUA 1QGDA 2NV0A 5E95A 4YWJA 1K3TA 3WNBA 1RWMA 3M6XA 3OLVA 3KXIA 4CN8A 1YVPA 1WXQA 3WP1B 2AQKA 3OEWA 1NWHA 3RRBA 3H75A 4WSOA 4PNZA 4RA9B 4ZI3A 2HA0A 4D81A 3LCRA 3GA5A 2C0PA 3B1ZA 4OSEA 1D3AA 3ROPA 2HSEA 2FEPA 3HSKA 4PHCA 2AEJA 2GN6A 4KQCA 3F78A 4RE6A 3K9LA 2GX6A 4YAGA 3FPSA 4RLSA 4EPTA 4X8MA 1N3IA 2WC1A 3LWBA 2AFIA 3HHEA 3C1TA 1AKMA 1VMKA 3UT0A 5CFLA 3RASA 2WM2A 1J23A 1MRNA 4OQMA 4HBZA 3P71T 4RESA 5CBPB 2A94A 1A3CA 1HLPA 5DTMA 3KVOA 4TYPA 4MWTA 1CUWA 1Z5UA 5THQA 1QTIA 1NG9A 3RG2A 3U7IA 3NHWA 3BGIA 1N6LA 4L5YA 2CNWA 3B20A 3I4FA 1MX9A 1W5EA 4A26A 5TT1A 4WKNA 2QRKA 4G9GA 2X0DA 1V41E 3LC2O 4J91A 3GMDA 4ZGWA 5KQSA 5E7JA 4RIGA 4I9NA 1V45E 4MS4B 4I66A 5T4EA 1EGAA 3DD1A 4GIBA 5FJJA 1ZP6A 4CLDA 3M0EA 3N0WA 4B4DA 3I2JA 4AKIA 3PX3A 1Y4ZA 5DFAA 5D6OA 4X3OA 4BYGA 3FNQA 2I3AA 1VB5A 3HFSA 3NWBA 1FS4A 3EQ7A 4G1VA 1UPCA 1WULS 3GUZA 4KR7A 1PS8A 2P6RA 3ABOB 5FKJA 3AOEA 5JD4A 3PZRA 4MV8A 1PK7A 4O4JB 4Z3KA 3NRJA 1XBTA 3DFMA 4FN4A 1B6GA 2C5FA 2Q0XA 2ZRNA 3PIIA 2UYCA 3C5EA 2O20A 4R1PA 2I66A 1UBFA 4CRWB 3QEAZ 3ZHYA 2PSFA 3H86A 4EEXA 1PEDA 1WQ4A 2KHZA 1CVLA 3FOCA 4IQ4A 2VWQA 3BHMA 5F35A 3SE0A 4DQLA 2WWYA 1EFVB 1VL8A 1NG1A 4L02A 2HQRA 4LMBA 4RY8A 3C74A 1P31A 4EFDA 3SVLA 3CG0A 2OCIA 3R0ZA 3EYWA 4HPXB 2XRFA 4P54A 5EP1A 3IQWA 2MWMA 4A8HA 1JHAA 2YNMA 4PYJA 2PZBA 4HMQA 2JEOA 4RD2A 5KNLA 2EKZA 1XQXA 1JAIA 3QKIA 2Q5LA 2VA9A 1LWNA 4PSUA 3SEZA 2FHSA 2VPQA 3DQQA 1G2QA 5D84A 3ZWYA 3BFXA 3PTZA 1YRYE 1XEXA 3EF0A 3UG7A 5KVSA 4YRJA 1NXWA 1VKJA 1BSVA 5BVHA 4N03A 1KA9H 4E1VA 1Y3FE 1T5SA 2AOXA 3DM9B 1Z4KA 3D4PA 1P0FA 1UM8A 2GVZC 3E7XA 3KKQA 4P3NA 3ESBA 3ETHA 3M3HA 4TTAA 2FQQA 5L4NA 3OEHD 3T7JA 3FVRA 4AY4A 1OZGA 1ULAA 5DTRA 5CDYA 4C0SA 7YASA 4E5VA 1MAVA 3CF6R 2DTDA 1OLUA 4MMXB 3N74A 5DXJA 3VHXB 2A4KA 2PYZA 3B38A 4TPKA 1RXUA 2AFHE 3FTEA 3NHFA 1B7GO 4D74A 1L5VA 2A2ZA 2YV5A 4IOKA 4M49A 3HR4A 3CHYA 2BGLA 3GPDG 4OMCA 4CIXA 4KGXA 1ORWA 5DNVA 3PUXA 2FPMA 4K1XA 3V8QA 2ZBUA 3ZCXA 3CR7A 1YI8A 4RVDA 2LNDA 1TC2A 4UPEA 2Z8YM 1L4NA 1TKRA 5DWQA 1VLMA 4MLDA 1NQOA 1P5HA 1KE1A 3ETNA 3FTNA 3GVHA 2SBTA 3N7AA 1ITZA 1NQAO 2XTAA 3W1EA 4CV2A 5J9FA 3PFFA 3KHTA 5GOTA 2WF5A 1EINA 4X6LA 1FZQA 4F6CA 1CNFA 1OD6A 1DTEA 2QORA 4FSHA 2HMSA 1KQFA 3A6EA 5CNJA 1VE3A 2NSLA 4NQRA 4ZYTA 3OQPA 2MSKA 3AL2A 3C39A 1RI4A 4PO8A 4LV6A 1PGQA 2YJ5A 2HF8A 3C7KA 1W4ZA 1VI6A 4O29A 1MHTA 2WJ3A 3EDYA 3GJ5A 2BEKA 2XMRA 3D2BA 3F67A 1KL7A 3FPLA 1PTJC 3QVJA 4GBED 3UQYS 1UH5A 3A4NA 3ZUPA 5CDSA 3ADBA 2COKA 1H69A 4LRXA 5H70A 2J31A 3SYMA 3UYKA 1QWSA 5EZYF 4E1BA 1JB9A 2E21A 1QHNA 2Q6TA 3OUTA 4FHCA 3QWFA 3OLWA 2H4WA 4MAAA 5JAMA 5G1NA 4D3DA 3G8BA 1LK0A 4TZ6A 3WL3A 2Z3VA 4DPLA 1NXQA 2PWAA 2H1HA 2NO6A 2Y6VA 8ABPA 5DNYB 1G8SA 3D3EA 16PKA 1J8VA 2P75A 2QD5A 2WWXA 3BIJA 1XTPA 3EAFA 4EIWA 5BQFA 3VTKA 1GZ7A 1TU4A 3F2VA 4YQZA 4HDRA 3F0TA 4HHEA 1H6DA 1ZESA 3NTVA 3F9IA 1AKVA 1MTOA 1DIAA 3MS7A 4OQLA 4QDZA 3VR0A 4CW7A 4EX7A 1JHQA 3RODA 2ASEA 2A9VA 3X3HA 3ZD6A 1I24A 1U31A 5I3ZA 1ZC4A 4FSDA 5TMBA 4BRSA 4EUSA 4B84A 4JX8A 1VKRA 4YBZA 4XB1A 1H1LB 5C2JB 4QTYA 1MB2A 4A2CA 4DIFA 3B3FA 4ND6A 5JEDA 3QUSA 1VPWA 4IEFB 5KMGB 4M86A 1YL6A 3GNTA 1W36B 4Q4JB 1NWCA 3ZIUA 3GPIA 3BXPA 5FUXA 1GSOA 4XD7D 3CCCA 1SD1A 2H0AA 3RVRA 3U3XA 3KWFA 4MS3A 4L9AA 3DB2A 2J0UB 3T0FA 4FKMA 4FQ8A 2GNOA 4OQNA 1E2UA 3IV9A 4KQ9A 5LZ5A 2J85A 4J0JA 3GFTA 4ZDWA 1MC8A 3TTVA 1NMEA 2F6RA 4MLCA 1ZCFA 4ZDKA 1I94B 1KJQA 2VRWA 4UNRA 3HACA 3IVGA 4JDPA 3ZU5A 4BB6A 1HETA 4HSEA 4FC6A 2JLZA 4M6WA 2QMHA 4S12A 1E58A 3UK6A 1TF7A 2X6QA 1B8VA 1R5JA 2WP8J 3L7KA 2Y1FA 3MWYW 3ZGOA 4EI7A 1MQAA 4L3WA 3A11A 3R8XA 4CF5A 1XOIA 4RADA 1IN5A 2SKDA 2CC2A 5CHYA 5TQ2B 3SKVA 1UT8A 3TOVA 1AK2A 4AWXA 1I1OA 4D42A 3AKYA 2PGJA 2JNWA 4P38A 5LLSA 4NI5A 1DKQA 3HXOA 4NCIA 4BNJA 1IBKB 1XV5A 4F8JA 1EAMA 2A0WA 2B82A 2B36A 3NZEA 3OJLA 4HAUA 1UANA 4QGHA 1I14A 2Q99A 2R47A 4RZHA 3WOVA 2G25A 5CX4A 4U2BA 4IKOA 5KX5F 3DAOA 2I34A 4LFBB 2O2YA 2WYOA 3TW0A 2WF7A 1PUJA 4BJ1A 2RAVA 5J4KA 1SFRA 2W6QA 5F2OA 5TS3A 1X7YA 3ZLTA 1PJ4A 1Q7TA 1W76A 2Y3IA 3L1VA 4M0CA 3COVA 4XIYA 4B83A 1X1RA 3N0TA 1BN7A 2UYHA 5BWLA 3FDXA 1L5NA 4DB4A 1UCFA 5BRJA 4HYQA 4LG1A 4MV3A 1GPH1 2JI7A 2VAMA 5LKRA 4LV8B 1Z25A 3KPYA 1EFCA 1WTCA 2SKCA 4C7OB 3B53X 4LGMA 4S0XA 4MGEA 5F98A 5AI5A 1I4DD 5K9ZA 5BSVA 3ELWA 2NQTA 1PBTA 3A05A 1VC2A 2V3CC 1U0RA 1AH2A 1D2MA 1LQ2A 1QRDA 2A67A 2BKVA 2Z57A 1FU7A 2IHUA 2WE8A 5E6SA 1CUJA 3TOXA 4DLLA 3DVRX 1QR6A 2UXCB 1DTWB 2X9NA 1ORRA 4HZUB 4BGIA 2J46A 3GDWA 3SYLA 4AY3A 1L7DA 5EZ6B 3RSGA 4EJMA 2MYPA 5KVCA 1TVCA 4GP9A 4R9SA 2GO7A 3WO1A 5C7YA 5I7WA 5DTQA 2AG6A 2CFSA 4RKRA 1NY6A 3TR6A 1I4LD 5CUQA 3ENWA 3ZGNA 5HM6A 3EYAA 4DIOA 3R3VA 1KR2A 2B4RO 2H1LA 2VPXA 4JSTA 4CLOA 1OZFA 1SUAA 2GRUA 3CGWA 5IJAA 4EJ0A 3CZCA 4KG7A 4MVYA 5HBGA 3KZNA 2P3QA 3A9SA 4RVNA 2NSYA 3Q0EA 2QRGA 5CA0A 1GNSA 1SEPA 4K9QA 3S2ZA 3DVAB 3N58A 5KNCA 4PN7A 1N8TA 3OE4A 5A5DA 1FNMA 2K5UA 1F0KA 4YO7A 4JBWA 1YI0A 3C48A 1SBCA 2AZXA 1OWMA 2PFKA 3OTQA 4NMLA 5DX0A 3QBDA 2YWBA 4NKRA 3PC6A 3O4VA 4KO8A 4RKQA 1ZI8A 2XUGA 1M74A 4MAFA 3E8XA 2UVDA 3V1YA 4DJFC 3FI9A 5BVGA 4A0SA 1QIDA 2NZUG 1FZTA 4PHTA 2FPPB 1Z33A 3RT7A 3KTFA 1CUBA 4UAVA 5LJLA 2QXTA 4OQZA 3KM0A 4BLQA 1FFHA 1OR8A 2WJIA 4LSZA 1Z4JA 1J7KA 4CDRA 1O5TA 1UWCA 1NLUA 2P11A 2UZ0A 2QUHA 1IZZA 3ANTA 1TQ4A 4UTXA 1Q57A 4MR9B 3NNDA 3PXGA 4ILKA 3RR2A 3ZHBA 5EMLA 4B4WA 4C6TB 5AW7A 1KEZA 2I1WA 3IUJA 5JCZA 1MFZA 2B3DA 4ZO6A 3C8HA 1KJ9A 4RHEA 4WWHA 5CVUA 1WXWA 1EBFA 3DDUA 5AI6A 4J29A 4QUIA 2NU8A 4TV8A 4QTTB 3DZCA 2CBZA 1KHTA 2CLIB 3T5BA 3KVRA 3VR5H 3UGJA 1Y1PA 2Q5QA 1ZHOA 2IYFA 4LDQA 3VR6A 1GR0A 3JARA 4IIHA 4TSFA 3T7IA 4MQ4A 5C7LO 1Q3HA 3OMWA 4BO6A 3UOGA 3S4YA 3STYA 4LJ4A 1WWKA 3AJ8A 4K86A 5AM0A 3ONNA 4ZGBA 1D1PA 2HF7A 2ZP1A 4MPRA 4N6OA 5H4HA 4HDNA 2JFYA 1J2TA 1KYVA 3KYBA 4BE7B 4AO7A 4G9BA 3PRJA 4J0FA 4W1QA 2HRDA 3ZE2B 2QZZA 3JAWA 3MJEA 2CKMA 1ECGA 1X70A 1U5BB 1TGVA 2DT5A 2Q4TA 3BH6A 4QVGA 4GRIA 2HIGA 3BCSA 1P73A 3P2YA 1VDZA 5DP2A 3T3DA 2O52A 1HNWB 2ON6A 1KEUA 3VKHA 2O8FB 1OT5A 2YV2A 4CCSA 4LW8A 2Y0PA 1WBDA 5JI2E 2GCOB 2IHVA 1COWD 4CG0A 2CHGA 1J06A 2OBXA 1G21B 4NF2A 3GB9A 3TOSA 4JC5A 1QGYA 2G5CA 1DO0A 4MVJP 4OH1A 5IFLA 1CR1A 3DT6A 1JLLB 1ZXLA 3HS3A 3NWEA 3WQHA 3SE7A 4PZPA 1XN4A 3AONB 2P4QA 1XWWA 2V6JA 2TMDA 4YH1A 3SR3A 1RPJA 4B6PA 4RO0A 2C4HA 4IXTA 4F2DA 1PDWA 2I4OA 3FYTA 5JALA 2C4NA 1Y8QB 1DBPA 1D4OA 4QODA 1NBHA 4O3MA 3D6UA 2FWAA 4JQSA 3W8NA 1ZGHA 3PE6A 3GP5A 1IK4A 4S1OA 3M4XA 1FVFA 2R00C 5ISMA 5EGNA 2VSXA 1IQ0A 1PR4A 1J0DA 2B83A 3H0KA 3FTCA 4KL8S 2PUCA 3IKJA 5CVTA 4Q3BA 4B4OA 3DXYA 1VG9B 2IXTA 4JJ4A 3RNLA 4KQGA 1II8A 1N6RA 1GA4A 2PWPA 1PEYA 2ODNA 3K32A 1MB3A 3KYDA 1MOZA 4S1NA 2ZVDA 4ESOA 2ZR9A 2PT9A 2ZAIA 1PTKA 4GQIA 5K0ZA 3E9DA 4L22A 2CL5A 2Z6AA 2XNDA 2XVXA 2ZEJA 2F2TA 3CU5A 3PJEA 3N2ZB 5LBIA 2Q2VA 2CNWD 4B8YA 4A2PA 4DLVA 1NJSA 5IXSA 2Q6KA 2I7DA 1KWGA 3W9SA 4IJUA 1Q3KA 3CT6A 3HXPA 3KELA 3A3YA 3HZRA 1MABA 3KWMA 3QX7A 4YYZA 5KWVA 2QG6A 4FE3A 2BBTA 3OFJA 4YRRA 3HPRA 4MHTA 4YCSA 2HLNA 1A4RA 1JR2A 4IKEA 4Z3DA 1XMPA 1N6PA 2CJWB 2OO5A 2VUHB 2GT1A 3G1TA 5U1PA 4BNDA 1W44A 3LT4A 3DBOB 3I01M 1ZVKA 2AC7A 5B7GA 2O50A 4ZYVA 2WZDA 4GGOA 2D5BA 4NS1A 4XDZA 2QRLA 1Q7BA 2NQ8A 1QOZA 3K5HA 3SSAA 4E2FA 1EFDN 1W4BA 2FZWA 2JI8A 3HVIA 2Z2KA 3TFQA 3ZYZA 4QA9A 3NV9A 4PO3X 1ZHFA 1CQJA 2JH9A 1O87A 4LVOA 4UHCA 2MYTA 2WWIA 1BEUB 3G2NA 3PIDA 1BWSA 2BFFA 2ZPAA 2G71A 5C1DA 2QTZA 1PJZA 1K6JA 1ZITA 1CUGA 1TEVA 2QZJA 3DXFA 5IZCC 1KMQA 3DKVA 4PAWA 1X7ZB 1RAIA 1U7OA 3IKLA 4JC4A 3W2EA 1RXVA 2PZAA 4UTRA 5KHLB 2H92A 3CE9A 5CDGA 1W7AA 4DTIA 4EX6A 1HT2E 1WDMA 2GA8A 3DAGA 4B32A 3D4BA 3QENA 4M89A 4GI2A 1RKQA 3E22B 2H51A 1PSZA 1SC9A 3RV4A 4AKEA 3EZ7A 4UFNA 5G3YA 4X65B 1FMJA 2XZPA 2VSOA 4O8CA 4BBAA 3S2UA 1BHSA 1GKIA 1JKJB 2PTGA 5A1TA 3VR2A 1FPMA 1NBMD 2E5FA 3QLJA 4QHSA 2GVNA 1Y7IA 3OZAA 2NUPA 3TKLA 2X9VA 2ZJFA 3T4PA 2J87A 1RBMA 3R9XA 2QI9F 4IUDS 4KWTA 4IILA 3LA6A 4NCNA 1FP6A 3VKFA 3OTOB 1OYOA 2XUFA 4H3SA 4HS9A 4TGLA 1VCHA 1ULHA 3UBTA 2V6FA 3T54A 3TLXA 3EXG2 1E20A 2C3PA 2QRZA 4FE4A 5A3JA 3OF3A 3NBAA 1DRUA 5JVDA 1T2UA 1W8DA 3R8CA 1KSJA 3LOUA 3HVKA 2I6XA 4BNZA 3RS8A 1XKQA 4HEA6 3T1HB 2BCEA 2A3NA 2CK3A 1R12A 3O1JC 4TKLA 1ZUWA 2XYQA 4BMSA 1EIWA 2XMCA 4I5GA 5TVKA 1UFVA 1JJBA 1VZ2A 2G8NA 3R7DA 4DPKA 2QAGC 3X1WA 3L6OO 4GOJA 5GZ3A 1G20E 3ESAA 4F5EA 2QEQA 1TADA 3MGGA 2BHRA 4IOLA 4KB5A 1DRJA 2XHZA 4U7PB 4FEGA 3S1AA 1TDJA 3MELA 3SZ3A 5FQNA 4WN9A 4JR1A 1JIVA 5ANRB 1Q84A 4B6JA 2FUKA 1DEKA 3MWDA 1G3MA 4BFYA 2W7TA 2DT8A 2BV3A 2CDCA 2JC3A 2P68A 4Z51A 5JCXA 2VQ6A 4J7CA 2NPOA 3JQAA 3CPSA 3QBEA 2Y2UA 1OJ7A 3NP9A 1KMHA 3GEEA 3K1AB 3Q7PA 4J2TA 2QE6A 2OCAA 5B7QA 4LI0A 1UFKA 3G8CA 2GA9A 2JAPA 2XE8A 3K0KA 2BGJA 3L0DA 4C3UA 2QRQA 1R37A 4BQOA 4KN6A 1MUUA 4F9TA 4KXUA 3FTDA 4S0ZA 3U31A 5JCPA 4FHFA 1RC0A 1N77A 4Q7LA 1EKXA 2R7LA 4B5KA 4MK4A 1YMUA 2QTNA 3E7FA 4LHEA 4M8KA 3WYEA 4WZ6A 1JQAA 2HNBA 2QTHA 1LPOA 3GWGA 4BGEA 1M76A 4B6RA 1Z4MA 5EPEA 5A04A 1E4VA 2WU3A 3COPA 2ATEA 5BV7A 5AM3A 1JSCA 1XXHA 4DR7B 1G8GA 1QRAA 2HLDA 3SBDA 3ET5A 2G1PA 2ZJOA 1PNVA 3KLPX 5D3MA 4C4XA 4IEIA 4TV9B 4ZZ0A 4AKTA 1G41A 4TKZA 4FINA 4R41A 4TMVA 1NQVA 2R6DA 3FZQA 1DS6A 1Y4AE 4HK4A 4XJVA 3SS9X 1C1XB 4D97A 4EGAA 3U16A 4TYYA 2VP9A 1G1MA 4HEA1 5EJ7A 3NBMA 3J81A 4I4CA 4TUYA 1N6OA 2I71A 2PRSA 2A78A 4FDVA 1CCWA 1G4UR 4WN3A 4D0LB 1MENA 3KEMA 3VUFA 1RRGA 2A5GA 3EWAA 4NIMA 1C7JA 4L4YA 3UZUA 3Q3VA 5AI0A 4B43A 5ALWA 3SHVA 3UJNA 2ZRCA 5DIZA 3G9XA 3ZWNA 2DKFA 2AWOA 3REQA 3IQEA 2HF2A 3WK4A 3EEYA 4RIIA 1AQJA 1T0UA 1YIAA 1Y3IA 2BZSA 1DKOA 2ZSDA 4L0QA 3TIGA 1X7HA 2P90A 4YDSA 3UJPA 2F1OA 2I9KA 1EFTA 5ITZA 1R5NA 4BE4A 4ZGGA 5KSPA 4AMUA 2XGSA 1X1BA 1XVUA 1XA0A 4XOIA 2I76A 1M10A 2DC1A 3G7UA 4URFA 4BRZA 1J1IA 5AW4A 1WKCA 2EFDB 1BEZA 1C9NA 2GD1O 3OT5A 3AVUA 5AKKA 5HRCA 1U6JA 4Q0MA 1DCTA 2BGMA 2QVGA 1FMTA 4EQ6A 1SXJC 3ICOA 1YULA 1QU2A 2P7IA 2RMKA 1T8RA 3H8SA 3E4DA 3ZDCA 2ZSFA 4O2BF 1QPBA 1WLSA 2X2FA 3N6VA 2V8OA 3HB7A 4WKOA 3ZGYA 1XZCA 1N2BA 4OGFA 4CR7A 3T3MB 4BASA 1JA9A 3Q9NA 1HMPA 1O0BA 1PJCA 1LI7A 2FN9A 1G42A 1MF7A 2PKRA 4H7DA 4HFJA 1T2DA 2ALJA 2DHRA 3DOOA 2X0KA 3EK2A 4OKIA 4TLAA 4ALLA 3NXSA 5FYDA 2VBCA 3ZD8A 2W8BB 1BG6A 1QGED 1XDWA 4ZDJA 2ZSKA 2JH8A 4QYWA 3NX4A 3ZLBA 3LPDA 1HSZA 2ZSBA 1AZLA 3FBWA 4PYMA 3RVSA 3GEBA 3QE9Y 5DCWA 1LTQA 4N5IX 3RADC 1TM4E 1ZIXA 2XUAA 1F7VA 2YQZA 4LZJA 2IYLD 1KS2A 3A32A 4PZLA 1J2JA 4PIVA 3S27A 3AFGA 4KXMA 4RF3A 1GDHA 3OHPA 5KSZA 3H19A 5J58A 4CBVA 1AGNA 3NIFB 5DF1A 1IRXA 4LA4A 1RYEA 1C8VB 1RPNA 2FOIA 4MVJH 3SKYA 1ENZA 1MJNA 2QBYB 1GSAA 4FILA 2Z4SA 1XZMA 4YXWA 3L0OA 3H9EO 3EDCA 3QK7A 3AM1A 4ES6A 1T0HB 3WLIA 4JJKA 2M6KA 4MDFA 3UKOA 5DHFA 4K9KA 1TECE 4ENWA 2HU8A 5H3LA 3E7WA 2HHLA 2I6TA 4OTZA 3FJ1A 2ID7A 1NBIA 1N5LA 2IXEA 3GUUA 4LJAA 4CQMA 1BXRB 1T9CA 5EOVA 2OPHA 4DCOA 2ZJBA 5CD1A 1P6QA 2EBFX 1DO2A 2IU3A 4YJ2B 5IKXA 3CF4G 1Q0HA 2R1TA 2WEKA 1AHIA 3J81k 2XWSA 2W93A 4WA7A 4PCVA 5ADUS 1JE0A 3V1MA 3T3OA 2A86A 5JV5A 2BBSA 5KKCA 5IVKA 5EMNA 3U7RA 1C9MA 4IGAA 3EMBA 3TGLA 4D9KA 5K8VA 2P4EA 4FXPA 2Q7DA 4BO4A 5CG1A 1AVTA 1X19A 3QFTA 1BE0A 2R2AA 2FTKE 1WOMA 1ZDMA 3ESQA 5BW6B 2ZTMA 3LHKA 4IIYA 3JWHA 3SF8B 3HKCA 3QEBZ 3IUSA 4CCYA 1HR0B 2ZIUB 1T5HX 3GZNA 2EYQA 5M7EA 4ESVA 4RK4A 2Q2QA 2DSTA 5E4TA 1ZSNA 3N5KA 3AEKB 5J4LA 2M6RA 1KMIY 1KNQA 2ODQA 4YFYA 2H57A 3A6FA 3CF0A 3NWJA 4QM6A 5CYPA 1F8GA 1IIRA 1J00A 1L4LA 1I10A 1T9GR 3KKOA 3PD7A 4PPYA 3TLZA 3RBAA 2PE5A 3WHPA 2C3MA 3WYGA 1CEEA 3B2QA 4F3TA 3E9MA 3KQUA 5HCIA 3BICA 4BWFB 1HUQA 2O7SA 3H4MA 5KJ6A 3RC3A 1QC5A 3UH0A 4G0VA 4X71A 2D7CA 1ZK2A 3HDQA 4RS3A 2YTZA 2XMQA 1ECBA 3EARA 2O1SA 2BTQB 2D2EA 4OV6B 2V1XA 1BHQ1 4JUBA 1ADYA 4M87A 2FSFA 4X00A 3URKA 2DETA 5AHWA 2BHSA 1C4KA 1REQA 1KYZA 3CTMA 4JLUA 1F14A 1UK9A 2QL5A 3UJ6A 5IWAB 1OZ0A 2I7XA 2NWQA 1N2CA 4MYUA 3S68A 3BCRA 1XQYA 4DCTA 2HMAA 3FNFA 3AF6A 4WMLA 1V96A 1U2TA 4WNAA 1T6ZA 2XBLA 2A1TS 3BE8A 1FLDA 4P33A 4QYXA 4MWBA 2R1VA 2VF4X 4HWTA 3JR7A 5J4HA 1JBEA 1UPAA 1GP2A 1YZHA 2B8JA 3Q40A 2L69A 4JYMA 3EA5A 1SQSA 2MSEB 3MM4A 2R7AA 3D7LA 4INPA 1PVVA 4Q05A 4ZP1A 1L7BA 3D6TB 2HGSA 2QP9X 5EE1A 5FHRA 5A9RA 2AN3A 1A9OA 4H17A 5DH9A 4NBNA 2CNOA 1H3NA 4AU1A 3PFGA 1F1BA 5CXSA 2HCTA 3EF1A 5T67A 1KI2A 3F2IA 2JVIA 4CM8B 1K5GA 4BVBA 1E6KA 4LPKA 3HR8A 5HILA 2BOVA 4K5QA 2PN1A 2Q5JA 4K0RA 4MW1A 1KEEA 2C59A 3CYFA 1EDEA 1SHUX 3FNEA 1QG4A 2VZLA 1Z4LA 1V8ZA 3KLNA 3Q9LA 4F1KA 4MPTA 2DKNA 3OWHA 3W0LB 1KK1A 3UJ8A 1ZJYA 4GWLA 3MGBA 5HF5A 4PS0A 2I7CA 3UWOA 3V6MA 2WHQA 1YDEA 2JCSA 1IZ9A 3CKLA 4EW6A 3X1JA 1YCFA 2IV3A 2O5EA 2PCLA 1EK5A 1G3RA 2VJAA 4TV8F 3WL5A 1Y1LA 2IH4A 3HDTA 1A9SA 2ERCA 2CXUA 4FGJA 3LUBA 4C07A 3PT5A 3VPSA 1MDFA 3ICCA 3DOJA 4IFTA 2ZIWB 2A59A 2R7MA 2XUKA 1DQRA 3DOCA 4O2LA 4TWZA 3UAXA 4DMUB 5AW8A 1F4PA 1P1JA 2HLPA 5K05A 7MHTA 3QUAA 4QNMA 5HF6A 2VJLA 2VHQA 3IUQA 1P6XA 4KQFA 2VPTA 3DNFA 2D0OB 1G8MA 4ZAYA 3ZY2A 2ZI6A 2WU4A 1RJFA 4X1IA 1IHXA 3G7NA 4EL5A 2PX0A 3F5DA 2XKBA 4X6YA 3ZIDA 2JBAA 3K2BA 5DW3A 1JR3D 1TYEB 1X77A 4CUJA 5AUNB 2WTUA 5GTDA 3Q1LA 1QG0A 1BW9B 2WKQA 3DMTC 3SBOA 5H7XA 3ZHUA 1MO2A 4GLFA 2XY4A 5EL0A 3WV5A 3QVGB 5AW0A 4AG6A 1XDUA 2CXTA 1ZGBA 3RVLA 2R5WA 2HUPA 2ZBFA 4R9UC 2PXCA 5JNLA 3W8EA 1E79A 2D5AA 1DUVG 2ADMA 1SULA 4M7WA 1DOHA 2UZ1B 2WSBA 4UASA 3HEAA 3NKFA 2X7JA 4FYWA 4US0R 2A7XA 5ALOA 4O2AB 4OJYA 4JI8B 3PX7A 5TMPA 1YFKA 3HVJA 3BXHA 3C3CA 5ALSA 5IVIA 4R2JA 1UT5A 2GHIA 2QQFA 1NOJA 3AEUB 3NGLA 3RUIA 3IA7A 4YP5A 1E0AA 1H9AA 3O2JA 5JD3A 3DHNA 1WHSA 2R79A 4QRIA 4A8JC 2RB4A 3GELA 3ADKA 4WD3A 1FRQA 1VLLA 3MAAC 1R4MA 2PSJA 3GJ8A 3EVDA 2WYHA 1Z74A 4LYGA 4BU1A 4B3IA 4BV8A 1K8QA 2JFUA 4MTLA 3ZVMA 2OCYC 3RANA 3N07A 4D25A 3V8RA 5CLIA 3GJ0A 1SU8A 3W2HA 5CGZA 2ZRKA 4S2UA 2YS7A 3CF2A 3N70A 3GXOA 5DM1A 2KPOA 4GKJB 2DCUA 1QKJA 1XJ0A 4FYVA 4EUNA 5FOUA 4YX9A 2DX7A 4L51A 4D4MA 4G0OA 5EJ2A 2XEXA 5EIHA 1PWXA 1ZKMA 2DCMA 4IINA 3RVKA 3HNPA 3VH4A 5JNWA 4LBZA 2Y67A 1IYZA 4UEQA 4DNXA 3NNSA 4A8JB 1Y4SA 2RKBA 2V7GA 1KE2A 1KK3A 1CF2O 1D07A 4E32A 1ECJA 3CO0S 1TXGA 3QVOA 3QLUC 1PS0A 4KN8A 4L4SA 1W34A 5JWHA 3KPUA 2WWWA 2H7VA 5LNK6 4O63O 1FFXA 1G8KA 3I3OA 3WWOA 5AKZA 2JKZA 3AR4A 4J1SA 3IKTA 5KC8A 3VR2D 4NCXA 4REQB 3WGVA 4QARA 3KE9A 4TLLB 4XYMA 1BX1A 2HK9A 3ZE7A 4D0SA 5B7NA 1B6SA 3AHIA 3M81A 5I45A 4ALJA 1KRHA 1DAHA 1DDIA 1UL1X 5CT8A 1O6CA 4YP6A 3FOWA 1QZXA 4R6WA 1ULUA 5DNAA 5MF6A 1X8JA 1AV6A 5BN3A 5BR7A 5BNWA 3S2SA 1XVAA 2ZYSA 1Z68A 2VSQA 4TSRA 3FPFA 3Q11A 2VHJA 1E5VA 4OQEA 3PR1A 5ERGB 3BTOA 3G9TA 4LTDA 2LKDA 2O57A 2ZI7A 3K73O 2G9QA 4K9NA 4QJ3A 4TQUS 1SOMA 1WG8A 5FO1A 4DBLE 3ZKWB 5F76A 4CM3A 1K5PA 1EJBA 3JZAA 1UZMA 3GUHA 2QL7A 2C5GA 4PX5A 4X85A 5EE5B 5GY7A 1QRSA 5THXA 3IQGX 1VYTA 1N5DA 2EZ9A 3K9BA 3OIDA 1PT8A 2P5SA 3EH1A 5K3AA 5G02A 1B1CA 1GTJ1 1SZJG 2FEWB 3ZH9B 1PP4A 4MUYA 5EZYB 3FOZA 1M5RA 4D5GA 3GFRA 1TZMA 4PGMA 4Q4AA 3JQAD 3V3KA 4EVIA 2YBEA 1XDBA 2UUAB 3R0XA 4QQKA 4WZAA 4CM1A 2BP7A 1Z0KA 1N0IA 2RAPA 821PA 3HNOA 4MWGA 1JZTA 3LVBA 4OATA 2FJUA 3Q85A 5CIWA 3NAGA 3ZCQA 6CHYA 1JHPA 1JEQA 6AT1A 3FSJX 1UWLA 3C3KA 1G2PA 1GTMA 1Z2NX 1W1WA 1TAUA 3RJ9A 3NS7A 3FHLA 4R16A 4FFPA 5LNK1 2VHEA 1KKMA 1H4TA 3Q88A 1L3BA 2OLJA 4UVIA 3MCVA 1ZSYA 1AN0A 4WI1A 4JB0A 3SOPA 3QU9A 4U7GA 3VTZA 3K0HA 3QNWA 5TR9A 1GTVA 1O54A 5J2UA 2CJFA 2DEUA 3PHGA 1W46A 2W2LA 3HG7A 3M6IA 2NNLD 2HLDD 2ZDGA 4U00A 2VAVA 4FOSA 4R68A 5EUBA 3U2QA 4EYSA 1R6DA 4HY3A 3Q7QA 3EFHA 1IJBA 2YBDA 5IBQA 5A5GA 3LVQE 2FZ5A 1DG3A 2XA9A 3NHRA 4GEGA 4E6EA 1VG8A 1AGRA 2J5BA 1UKEA 4YLGA 4E5UA 5B4UA 5JDCC 1QCZA 4RGYA 5H68A 2MT9A 4TKUB 5KVAA 1NZDA 3R5JA 3SS7X 3HRIA 2J33A 3R6LA 4UE2A 1W88B 2ZJZA 1HRDA 3PHIA 4IDDA 5CK4A 3H5VA 3HB0A 1OUMA 4AG5A 4MO9A 2VPZA 1MB9A 1PJ8A 1P1BA 3EGIA 1YA6A 2DWCA 2YZNA 1QP7A 2Q8NA 1R0ZA 3K8YA 3PFCA 4LYEA 1KI9A 2YVKA 2QLBA 2L19A 2ZRAA 3CZPA 3WMEA 5LWHA 5JS7A 2CY0A 1VFNA 2HUNA 1OH6A 1UP6A 5MN4A 4EPWA 2LDXA 3OIGA 2WPDA 4MVJE 4IFEA 2Q49A 3DTVA 4HR7A 3GCZA 2ZROA 4W1SA 1VM6A 5GM1A 3W5UA 3RQIA 2OORC 4YP1A 4DEVA 5ICGA 2PTHA 3CBGA 2FW9A 1GG9A 2PLFA 2EJVA 2ECQA 3BQMB 2Q4BA 4FFRA 4X94A 4Q7QA 2P40A 4NJEB 5IVHA 1BVYF 1OV4A 1EUYA 1E2FA 4L8FA 2PWBA 4L4ZA 4I8XA 2H9AA 3G0CA 3SZUA 4EKEA 3HR7A 3I73A 3RRZA 3HKDB 1T0IA 2V7WA 4R8SA 4I1RA 3MMZA 2HXYA 4NNOA 5TPWA 5KX5B 1G38A 4LJSA 3JWEA 2CHEA 2HDNB 5JZBA 5SZIA 5FX2A 2CE7A 4KWIA 5TVGA 3QOFA 4BV3A 1JLMA 1M1ZA 3ZWOA 1EWYA 1OFGA 2IPOA 3G82C 1VTKA 4RIEA 4TTTS 4X45A 3WKCA 2DJIA 1MQ8B 2XAAA 2DY1A 1D8AA 4M22A 1KDPA 1Q20A 4M60A 4E7PA 1SVMA 1KY4A 1ZQ9A 2F43A 4EK9A 1G6OA 4JAVC 4JT8A 4F1JA 4HRVA 5C1IA 3G02A 3K8OE 1NMXA 2R8EA 4ZODA 3N8GA 9ABPA 2ZBDA 3GG2A 3KO8A 4Q9AA 2MR5A 4GM4A 5K51A 1JMVA 2GEJA 3CURA 5CM9C 3WLFA 1JHDA 3CPJB 1X8KA 2W9XA 1FVHA 2I3DA 4MITA 3RWOA 3T7RA 1NDQA 2FWRA 4OHMA 1BROA 1ESEA 1XCOA 4AS2A 3SSNA 3HA7A 3WRYA 3CMMA 2Q3LA 3RC7A 1FYEA 1HYQA 1RHQA 3TSOA 2FPOA 2BMVA 2Q2OA 4YXWD 4KHZA 1BXGB 1ABEA 2P9QA 3OA2A 3ZUGA 3VZRA 3GWZA 2NNWB 4MZDA 5SY9A 3DPSA 1UPUA 5IBPA 3WX0A 4J16A 1KDTA 2BFBB 4HLQB 5E1OA 2GEFA 3VPFA 1KRWA 1H8ED 2JFPA 2IZ1A 4EGCB 1A97A 3D0OA 4CQMD 4BYMA 1F0PA 2BD0A 2XVAA 3CRRA 4M9QA 2ZFUA 5FTLA 3VOTA 1JDVA 2WTXA 5GONA 4YQFA 4UE6A 4WK2B 4H77A 3U39A 4BLOA 1U80A 2IL1A 4MR8A 2VH5R 2Y1WA 4PLWA 3A7EA 3N1UA 2OLEA 4ZAVA 1AKNA 1J8YF 5LB2A 5JIBA 1RD4A 1UEIA 1XF1A 4PLGA 1JEYA 2GBLA 1VSVA 3UCXA 3OAAA 4BGDA 3T99A 5BYAA 2PH1A 1QO0A 3L8FA 3K8ZA 4XX0A 2Q27A 4OAOA 1TJYA 3KOXA 4HRYA 2QX4A 4Y7CA 4EZIA 4QREA 1UMBB 3N2GB 5BR8B 4E5DA 1M6YA 1XC7A 3BMOA 1IEXA 2C97A 2XD4A 4ND8B 4KREA 4OXXA 4C21A 2YWRA 2AZTA 2HSGA 3VU0A 4K6OA 5KS2A 1U5AA 3LY7A 2DH5A 3GJSA 3JPYA 3W6OA 2BN4A 1QK4A 4OK5A 1EX6A 4XDHA 1BMQA 3T35A 2YXDA 1O94D 2BM8A 3H84A 4RSHA 3TCNA 4ESHA 5JATA 2IIVA 1RXWA 3NM6B 1JHZA 4Q1CA 4QEZA 4F3RA 4QHYA 5FORA 3OZBA 2BFCA 5BQPA 3UXMA 5SYMA 4A5SA 1UOQA 3ESYA 1P2UA 3A9WA 5LYJF 2J9XB 1VPVA 1M83A 3EGDA 3J80A 1Z37A 4FR2A 2VUTA 2ODBA 3GOQA 4JYPA 1PQUA 3UATA 2F1RA 1UJ2A 2BKLA 2AGVA 3K2IA 1E9VA 3DJYA 3MINB 2QQ5A 4FGUA 3I6BA 4WX2B 3ROXA 1B42A 2AG0A 2PZMA 1XTUA 4N18A 3JRWA 2H48A 2IK8A 4NYJR 4DCGA 5I9SA 3VR6H 3I9V6 4JK3A 2QX6A 4XSHA 3T38A 4YAIA 5K03A 3ITDA 2PEZA 1PCXA 5ALPA 5A0TA 5JI3E 2JFVA 3QZUA 3KFXA 1OZAA 1ZH4A 4Y9SA 4Y0NA 1G5RA 4FYYA 2OZKA 3DS8A 3QPDA 4FZ3A 2I4IA 2XE4A 4WESB 4LRYA 3A6HA 3HTXA 1ZIDA 1UJ4A 5C80A 2I65A 2PUDA 4WLFA 1E4EA 2Y71A 3ENZA 3NPAA 3PVSA 3B7WA 1PQYA 4UHDA 1W85B 2Q8PA 5IF3A 3P5BA 1J56A 3ZV6A 3D5EA 5FAKA 5CLGA 4GYWA 1ZWKA 2JGDB 4JUDX 5DNDA 1KDVA 1NUTA 4JU8A 3B12A 1K92A 5JPIA 1AMUA 3EIHA 2FLWA 4IDNA 1IM2A 3NBYC 3WBKA 1TA0A 3DWFA 2WTEA 2V4ZA 1LB1B 1FJHA 1WVGA 3A4VA 3CIFA 2Z8ZA 1QH1A 4WADA 3VM6A 2JGFA 1YKFA 3L4KA 1WB4A 3U60B 3AQIA 3MWEA 1USKA 1JL3A 3F74A 2ICAA 2FJ0A 4IGIA 2HN9A 2IYXA 3U81A 3RYCB 5IM4F 1ZJJA 2R7KA 4I99A 1JKIA 2FF5A 1X2BA 3OZDA 4E1AA 3AF1A 1ODTC 4UM5A 4V0LA 3SD7A 2W2QA 4I2VA 3GUVA 1JZSA 1EWKA 1I30A 3TW4A 1O97C 2DLNA 4PV7A 4QWMA 3SXJA 1I7QB 2JKVA 2XMZA 4H7FA 2AQ8A 3DE3X 3VVLA 1L8OA 1XQ6A 3GNLA 4UBJA 2WWHA 2WWGA 2R8BA 3E05A 2FJPA 3GFFA 4TRNA 4BUCA 2ZWIA 5B1EA 1I2DA 4HNTA 4KSCA 1Z8FA 3EIEA 3EGVA 2AF4C 1BKSB 1J49A 1BHJA 2FR0A 5LBUA 4ND4A 3EVAA 3A9RA 1Z15A 1JJVA 3MQ2A 3V7UA 4BTVA 1NBME 2VNJA 3I9V1 3L7AA 5D6NA 1RE0A 3O8OA 1YC2A 1Z7YA 1MA0A 3B6EA 2FFRA 1XTIA 5HQ3A 4D9BA 1XLUA 2BEVA 1OC4A 2C78A 1SZPA 1YZQA 1GV0A 3RTAA 2Q1UA 1ODJA 3DL2A 5EP4A 3LBIA 3MIIA 2HZBA 3PGMA 2O8DA 1GNTA 4O4HF 1PYOA 2Z56A 1OPRA 3NI2A 2AFIB 3P20A 1LTKA 4PICA 3BD9A 3I5YA 1N1MA 2NZ8A 2E0IA 1SCUB 3KYCA 3MNFA 1V3TA 3GLQA 3WHIA 3P1JA 1R50A 1OXXK 3UXHA 1E79D 4TRMA 3ZV5A 2QI9C 2MSWA 4OB6A 2AIRA 4DREA 1WZUA 2G82A 2OAP1 3ZBTA 4IQ8A 3GLHB 5FNZA 3WR5A 1I7DA 3N59A 4KGVA 2VDPB 1E0KA 2OESA 1Z7WA 3NYWA 3JQ9C 4GGMX 4RDIA 2YINC 3FYUA 1BYIA 2OV4A 1P7PA 1UJ5A 3D6VA 1O89A 3DCIA 3TLYA 1FPQA 1EWRA 3A6LA 5ALJA 5U9CA 1HF3A 3AUYA 2HSDA 2Y9PB 3NTXA 4I7EA 4BKMA 1IY1A 2NU9A 1U11A 1U65A 4J0DA 2OHVA 5E4FA 4OI2A 3LA8A 3N8IA 1UDAA 1WW2A 1SHLA 2W83A 4YV0A 4LOHA 2WSSA 3BMNA 4O08A 1HTWA 2NIPA 4X1YA 3VYWA 4YLEA 5CR9A 1JG4A 4O3FA 1TCUA 2CL6X 3FKQA 1KO4A 1E1MA 4CKXA 1CZKA 1PS9A 3LHDA 4WLVA 1CEYA 5L3RA 1U1DA 3OJFA 4KQ2A 4EW2A 1WU8A 3AVTA 3C5CA 3QVVA 4YJ3F 1Z17A 4UDXX 3S2YA 1FW8A 1I36A 1IAVA 4M98A 4JI0B 4CJXA 4EJSC 4YB8A 4XTRA 5KYWA 3PXUA 1VLQA 3TIVA 3UA3A 2Q3DA 1X1CA 2QTVA 3DM5A 4BTLA 5JAUA 2KSQA 3ZWPA 5HQTA 1AJEA 3BXGA 2GCNA 3NTUA 4AN4A 5A3SA 4DL9A 2BSAA 1JKMA 2WUVA 2C7OA 5JAHA 2NUTA 2HDHA 1MO6A 1CUDA 1E3MA 2N47A 4EHBA 1BRMA 1GQ2A 4TMWA 1CERA 3GP8A 2QTAA 5DLYA 1CRPA 4DCCA 2FSIA 3EZNA 4HX9A 4ZVRA 1HK7A 1BZYA 3O7MA 4DIKA 2Y0DA 1V4VA 3O82A 2RDMA 4Z4FA 1XEXB 1GPAA 2FPXA 1J8QA 3OE7A 1SB8A 5A71A 2ZIAA 1KJIA 2XI4A 1NI4A 5TJ9A 1FB5A 2H52A 3LCMA 4JLSA 2CLCX 1ID8A 2W2XA 1SVUA 3BE5A 4IBOA 4MSUA 5T41A 3AI7A 1E98A 2F1HA 3HEMA 4WEQA 2VT6A 1U3GA 3RFXA 3U17A 3CNOA 1JAXA 3EMVA 3K70C 5JMOA 2QDKA 2VPPA 3VR4A 3QEJA 1YCHA 1L5QA 4B48A 5ELLA 2IBTA 1A98A 1L6IA 3OQJA 5GV8A 2W6OA 3H8WA 1U63A 5LP6F 1AKYA 1R9GA 3G0DA 1Q7RA 1G98A 1LBTA 2DSNA 2WYVA 1HFEL 4RLQA 3FVVA 3UEOA 1JQLB 2OY0A 4IPTA 4F4FA 3PA8A 1PE0A 5AQ1A 5K6AC 1VJCA 2AJCA 3FUVA 4F4HA 3ZCTA 4L75A 3RVJA 5IT9A 2BR4A 2Q6OA 1M34B 2B4KA 1KFCB 4I08A 4F5ZA 4LDZA 3SDBA 2QD1A 3VI3B 3ZU6A 5FXMA 1UF9A 2MSDB 1K6EA 1Z5ZA 3AEYA 3MLEA 3QY9A 2GHQA 3NU1A 1ZSVA 2H2GA 1DZ3A 4EUEA 3K70B 1Y3CE 2PZLA 3U3JA 3QTLA 2PL3A 2LWIA 4YUYA 4FWIB 3T4UA 4ZT6A 1N1GA 2CWWA 3SNHA 2OV6A 2A5YB 1ST3A 2NXNA 1FTGA 4UBOA 2G0TA 1U0LA 3NC4A 3FCUB 3CUWA 1GSIA 2MIIA 1V26A 4I9GA 1TVMA 1RHMA 4H60A 2P9GA 1OBHA 3QWAA 3ZWDA 4UUBA 5FLEX 1B76A 1PVDA 4Q7MB 4DLAA 3JZIA 3WOHA 1BIFA 2ZT5A 2W2LD 3B60A 2Z9CA 3N7TA 3IHKA 1SHZA 4IZIA 2CNKA 4L16A 3RLFA 3Q2KA 4XYLA 3DQPA 3OQBA 3TFWA 4FFNA 1N2XA 1IH8A 1RYYA 1ETUA 2ZU0C 1VPTA 4HGNA 3GJ7A 3WFIA 1ZJWA 2FMFA 4KLRA 1CUXA 2SHKA 3ECCA 4CG2A 2I6FA 1DU4A 2AMFA 3CRMA 3HXTA 3P4UA 5L8VA 2AOUA 2IEYA 1L2TA 4KUEA 3HYRA 4HFMA 1K5HA 2XUDA 1LC3A 2UXBB 1L9XA 5BYKA 4TXNA 3WADA 5B6JA 2HQOA 2VF7A 4O2BB 3I6IA 3KT6A 4J6EA 4EEZA 3DXZA 4AJIA 1AZWA 2Z6UA 4R8KA 1NVVQ 3P4YA 3AIIA 2G80A 3ONWA 1RJ9A 4IL5A 2YWXA 4DY4A 4EUFA 1NFQA 1JVBA 2WPDD 2OGUA 2WU1A 3DTVD 4YJFA 4ZVUA 2GILA 2JIRA 1NLMA 3A14A 1NAHA 1YZFA 4HGOA 4FONA 1OLOA 4IRXA 3VYRB 5CB4B 5G0UA 4LIPD 3MWFA 4MS3B 4A6PA 2G4VA 1J90A 5CVDA 1SKYB 2FOLA 4U0KA 4PZAA 1MZVA 4JOQA 1USIA 1XN1A 3FPBA 1I3CA 3JQ7B 1P6UA 4M38A 4MUJA 1Z7GA 1L5KA 1ODSA 2JATA 2QN1A 2Y27A 3KVNA 3R3HA 3WXBA 4ZN6A 4URZR 1OFIA 4UJ5A 4C4AA 4FNMA 3QMVA 2RGAA 3MAJA 3HC7A 4RZ2A 1WSDA 2QA5A 1YVRA 4FYIA 3WS7A 4O4IF 2ZE8A 4PRYA 5TJHA 5EE0A 3B3JA 3GGJA 3KTOA 3QWBA 1UPBA 3LUFA 3UH1A 1WZCA 1XT6A 3ANSA 4QXPA 4TM8A 4A73A 4M6WB 3MEQA 4RETA 3IP3A 1H66A 2CGEA 2HQ1A 1YOVB 1QFZA 4ZVVA 3X1DA 4LBYA 2HJ9A 3L8DA 3WNDA 1VHDA 3TMYA 2G0NA 1HEYA 1USVA 4QPJC 4GYYA 3LK7A 3ZPXA 3BZUA 1QYCA 1U0HC 1YE3A 1RHRA 2OB2A 3G85A 3OMXA 3BK2A 4M0UA 1ENYA 4GMGA 1WETA 5B55A 3AVQA 4Q7JB 4DG5A 1ZYUA 1SVLA 1ID1A 3IV6A 1PYGA 1T2AA 4LDRA 2J3DA 1IBLB 1T5IA 2CFIA 2NADA 3LPLA 1FXUA 1L5FA 3TZCA 3VC2A 4AROA 1JFTA 2IVFA 3MCZA 4DRYA 3TL3A 4WVLA 4Y2HA 3EDMA 2C1ZA 3EWNA 3JWGA 5KNBA 1K97A 2P9ZA 4KMRA 4JBXA 1QCYA 2XUPA 3CLUC 2Z6QA 1X7YB 2O3UA 4UUAA 4C4ZA 3T3EA 2DWUA 1FY2A 1TYCA 2P2DA 3BSWA 2QNBA 4QD3A 1TO6A 2IZ0A 4X61A 1TK2A 1ZK0A 5H82A 4DWJA 2XCLA 3Q6IA 1G18A 2VNIA 4O1MA 5JNUA 3UJ7A 3MUEA 1M8GA 2PL9A 3AG6A 4J3JA 2BDTA 5AKJA 3BVPA 2QUKA 3AVYA 1QYVA 2ZXEA 1IEQA 3AWIA 1FSPA 3HJUA 5A02A 4R1OA 1DT5A 1S7GA 3R6TA 1SVOA 3VBCA 1KVRA 4EP1A 2H5IA 2QXYA 5E6SB 4DV4B 2RH9B 4KDFA 1UAGA 1OX6A 4FFLA 4C0XA 2VNAA 4FEYA 4EMTA 3PNPA 1YB6A 4JEUA 1RQGA 3EWIA 2NUBA 3KZXA 4C4RA 3OAAD 4FX5A 3NNNA 3K5PA 5LZ7A 1ANKA 3N8NA 4X6XA 3AY0A 3I2IA 1QNLA 1U7ZA 2C57A 2W70A 3LTNC 1VMEA 3A6GA 4ILEA 4JX9A 4HXYA 4BX9A 3IE1A 1RQXA 4NH4A 2AEFA 1VJRA 2P0EA 2QM3A 1ZH0A 3VU9A 3STWA 2J7PD 4D8XA 4CLOB 3SX0A 4BHTA 3USCS 1E5DA 2G9UA 4BX8A 1II9A 3KV1A 3VDQA 4NZOA 2QMQA 1N1EA 1DXHA 5CA0B 1BJKA 4P7KA 4U6SA 3GLGB 3O3MB 1QXSA 2WJ4A