6FDRA

7-fe ferredoxin from azotobacter vinelandii at 100k, na dithionite reduced at ph 8.5, resolution 1.4 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords PROTEIN (7-FE FERREDOXIN I)
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fdrA00
1Y4ZB 1AXQA 3MM5B 6FD1A 2WSFC 1C4AA 1GTHA 2UZAA 1CLFA 4AYBD 5BYSA 2GMHA 3IR7B 1WTFA 2ZVSA 1DURA 3IR5B 1GAOA 4DHVA 1FD2A 2XSJA 7FDRA 4XDCA 2FJBB 3HKZD 2WSCC 1FERA 1FDNA 1FXDA 1B0VA 1BD6A 1SIZA 3MMAB 1FRKA 1KQFB 1SIWB 2C3PA 2GMJA 1FDDA 2PA8D 2C42A 2FJDB 3MM8A 1F5BA 3EGWB 2VPXB 7FD1A 6FDRA 1KQGB 3LW5C 3MM9A 1F2GA 1D3WA 2V4JA 1BLUA 2O01C 2WB1D 1FXRA 3OR2B 1Y5IB 5E7OB 4CI0B 1PC5A 1DAXA 1FRLA 2VPWB 1HFEL 4Y28C 3MM6B 4OV1A 2FJAB 2IVFB 1FRIA 1G6BA 2FJEB 1JNRB 2VPZB 1JNZB 2XSJB 1DFDA 1A6LA 1Y5NB 3GYXB 4XK8C 2PMZD 1BQXA 1SJ1A 2C3OA 2PDAA 2C3UA 1GTEA 1KEKA 1IR0A 1FRJA 4L6V3 4YDDB 5BYRA 2C3YA 3C8YA 1H7WA 1FF2A 2WSEC 2V2KA 3MMBB 3MM5A 1B0TA 3MM7A 1H7XA 1GT8A 3OR1B 3PNIA 3MMAA 1FEHA 2WAQD 3MM8B 3MMCB 1JB0C 1FRMA 5L8RC 1XERA 2FDNA 1FRXA 1FDBA 3MM7B 3MM9B 3OR1A 1BC6A 1PC4A 4OMFG 5FD1A 3MMBA 4ID8A 1FDAA 2Z8QA 3MMCA 2FD2A 5CH7B 1Q16B 2FGOA 2Y0SD 2V4JB 5BYQA 1RGVA 1B0PA 1H98A 3OR2A 1H0HB 1K0TA 2VPYB 1C4CA 1IQZA 1VJWA 3IR6B 1BWEA 3MM6A 4XDDA 2C3MA 1FRHA 3EXYA 1FCAA 1F5CA 5CHCB 4RKUC 1G3OA 1ROFA 4KT0C 2VKRA 1FTCA 1R27B 1Y5LB 3EUNA
chains in the Genus database with same CATH superfamily
3J7YI 4OHYA 1JJCB 3MM5B 3FKBA 1HWIA 4DL7A 4IR1A 1OY8A 3WIUA 1U25A 4Z2XA 4DR4J 5F8NA 4JB8B 1TKTA 5D0GA 2DNLA 1S5ZA 3PYGA 2ZUAA 4RBTA 4K0KJ 3GILA 3IRXA 3M2VB 1VC6A 2XC9A 1SJ3P 1D9FA 5LMNJ 2AQ4A 5HP1B 2XLJA 1KLMA 4RPFA 3VVTA 2W9BA 1ZTWA 4C9DA 2ZVSA 4BLGA 2WZ1A 5IQQA 4K2JA 4DCPB 4DZ6A 2RIJA 1RCOB 4YB1P 4HHHA 2OPSB 4D3HA 2DTJA 2W1BA 4ECUA 4WFXA 4WFAQ 2M88A 5C5JA 5EUHA 2OEMA 3NGUA 1UFKA 3OTEA 4I6WA 3J81U 4ES3A 4U7UK 2KT3A 1OQ3A 1WTBA 2BJ1A 3CCVS 1S6PB 3EM1A 1XMOF 2HFNA 3MMJA 4L3KA 1JLGA 3DDIA 5K8MA 2E5IA 2FHOB 1S0MA 2OJ3A 2KZMA 1S9GB 1X8DA 2C3PA 3K8WA 5G0RA 1WF2A 4K4WA 3K89A 3LAMA 1LWEA 4GVBA 4U8YA 3V6HA 1HHSA 2HEKA 4DQSA 1FJGJ 1TFWA 3NGSA 4RL1A 3QMQA 4EBEA 5LMUF 3D1HA 1DTQA 2HVEA 2ZOGA 4ZS6A 1VC0A 3ZO7A 1TVRA 2OLWA 4DBQA 4MYTA 3CC4S 1DTTB 4FBUA 2JEJA 3LPYA 3O3LA 2IHR1 5KFFA 2WVDA 2OPPA 1P1TA 4WBFA 1S1UB 5KFYA 5GAHU 2W2PP 5HATA 2GZOA 3S01A 4NA3A 3EX7B 2XYGB 1IBKF 5A8KB 4AL6A 4FYXB 3TVZA 2VA3A 3GSIA 2ZDOA 1IM4A 1RQ0A 3GG1A 3HT0A 2QC3A 3TEHB 3BF4A 2HVDA 2W01A 3MECB 3QT8A 1F6TA 3CCUS 1NDCA 4TY8B 2BRKA 4BCAA 1PBAA 4PYDA 3W2VA 5AE2A 3VAIA 1BGXT 4M5KA 2KKHA 3PACA 1EQMA 1SJ1A 4WFZA 5KFPA 1FESA 5GAGU 2ZJRQ 3T9ZA 4IKAA 1VQOS 4LSNA 1FK9B 1CQNA 1NXIA 4BHQA 3BGUA 3GJQB 3ILLA 3CJ4A 4DFJA 2CPDA 1FF2A 1RWWB 4Q0BA 3LH2S 4NCGA 1FEEA 4E8UA 1YG0A 2HGMA 3HVTA 2H54B 3MMAA 1JQGA 4GKJJ 5E0OA 1GMVA 2AW0A 3E51A 3EMTA 3GYNA 5C42A 2DNOA 2YNFB 1VQ7S 1FJCA 2A0FB 2JVRA 3Q23A 4MAKA 1K73T 3OL8A 1IWAA 2M5YA 5K8NA 3AFGA 2PI5A 2H4YB 4F4ZA 3E2EA 4RW7B 2BKOA 3ZZRA 1DQ9A 3MMCA 5KFIA 2FZCB 2MSSA 2XZWA 5J2PA 1GQEA 2CQCA 3H20A 2HGLA 3PYFA 1T9UA 1YX2A 3R6LB 4A8WA 2OTLS 4DV5J 3SSSA 1HPZB 1ZM2A 5HSPA 3NS6A 1Q8KA 2YKOA 4N41A 2XS5A 4NLQA 2J8AA 3W9HA 1T7PA 5F3ZA 2AJQA 1QTNB 1KHWA 1S7HA 3MPVA 4NLRA 1YITS 1PG5B 3CD5A 5BXIA 2E5JA 3KLGB 1YIJS 2LQ9A 1VQ4S 3RR7A 2E9RX 2IMWP 2XS7A 1RWMB 2IVMA 2HNYB 2VG6B 1IUJA 2F9JA 2KO1A 5I4MA 2DD8S 3OUYB 3VAFA 4OFZA 2XM3A 2R7WA 2E5HA 2KXFA 3BQ0A 1Q8BA 3DOKA 3B82A 4LSNB 4B3MJ 3MCMA 3GFXA 1HBMB 2JJ4D 4KHPJ 4LFAJ 2LVWA 3U1LA 2JOQA 2M70A 2Z4PA 2HHTA 2KZZA 4DWIA 1N48A 2JH3A 1UPPA 4FS1A 3H42A 1RT7A 4LR9A 3EVWA 1DLOA 2EFGA 1HL6A 3HVTB 4IG0A 5BR8J 1RTHB 2HQGA 4NZ7A 3D6FB 3DDKA 1L3SA 2FVRA 1TMMA 2HS0A 3F44A 5D78A 3MR2A 2IA0A 1T3NA 2D7SA 2VFTA 4ZVTB 3UWTA 5I3UB 1D0EA 5HO4A 4M95A 1O8BA 2WVBA 3BYPA 4QWEA 1VQ8S 4KO0A 3OJSA 3GYGA 2BDPA 4RUCA 5L1IA 4OL8A 2FHJD 3CD7A 2WONA 3UDLA 2BE7D 3HULA 1HI8A 3MCNA 2N82B 3TR5A 4IG3A 3BZQA 3OJUA 2QEXS 3H2LA 5KFXA 1B99A 1NRKA 2AF6A 3BYRA 3D5MA 1FRKA 3NG8A 2RMLA 3A3PB 1KQFB 4IFYA 5ETSA 3ZC4A 3KG1A 1QLNA 1K0TA 1X60A 4YHHF 1KBRA 1NZAA 3FCHA 2PA8D 2Z0GA 3T5LA 1N88A 2HW3A 3HJVA 3BO4A 4KGXB 4FYYB 1OJ4A 4RW6B 4MK7A 2BOPA 2I8EA 1SJFA 4X4SA 1WHWA 2BE2A 1QAYA 1K8AT 1WACA 3DOMA 3BR8A 3CCWA 3OTDA 3RB3A 4OYAA 1PJ5A 2EFOA 2WB1D 1VJQA 2V6AA 2YKAA 4DG1B 3POTA 1WNEA 1S1WA 4DX8H 4X4PA 4ITSA 4UOFA 1CSJA 5HJXA 1XR7A 1TL7A 5B0GA 4CP5A 3RG6A 4CLFA 2OP5A 3DI6B 2LQJA 4WXWA 2BQ3A 1N6QA 4URGA 2FZKB 4N77A 3RRKA 4CLPA 3CE8A 3UNYA 5RUBA 1E6YB 4RNHA 3V4MA 2ERRA 1N36F 2EPIA 3RBDA 1EB0A 3FCVA 2ZE2B 4A8KA 5I3UA 3W5ZA 3M8ZA 1RE1B 1WC3A 2CJ9A 2OUGA 3WQPA 1Q79A 1TV6B 2BQUA 1RT5B 1WI8A 4CDIA 4KH0B 4QCLA 1ZBTA 2HBRB 4HDHA 1M5PC 3QO9B 4LRCA 3OSNA 4DSIA 3BBFA 4J5OA 3KK2B 3NMAA 2VKZG 1X4HA 3KG0A 1VR6A 3MM7A 2XY7A 1SJ4P 1CPZA 3DRPA 2AEFA 3PNIA 8RUCA 3TP2A 3NNAA 2DH9A 2QA1A 2VF3A 2X3GA 5F9LA 3LO3A 4IOAQ 4NXNJ 1JB0C 2DY1A 1C1CB 5IQ6A 2MZRA 2XHWA 2ZBQA 3NLCA 3CMES 3P4UB 4DR7J 1XK8A 2AYMA 3MD1A 2QIFA 3GB0A 3QGHA 3UNGC 3AXMA 3L3CA 3OSPA 1N5YB 1I6JA 4ZP7A 2GQCA 4X64J 1TFYA 3ZFVA 1U1OA 4L76A 4RLEA 2HBZB 4LFBF 2KL8A 4PQAA 3FFIB 4WFBQ 2KFYA 2EG1A 3OPKA 4ECWA 1S1WB 3AOBA 3ZZYA 5DGAA 1S10A 5H1SV 4DPOA 4EO6A 4IUFA 3SCIE 4LF6J 1S6QB 4Y34A 2YKNB 2NREA 1FTRA 2DK2A 1X9WA 4B17A 4LFAF 4P72A 5MAOA 2ALYB 4HT7A 5AXKA 3TJ8A 1UJ5A 1U2RA 1C0UB 2G1HA 3N6MA 2M3DA 3ENWA 4OHZA 1GNKA 4E2FB 3HO1A 1U47A 4EYIB 2HHPA 2VKRA 1TL3B 1FTCA 5CCLA 1N56A 4MKYA 4QR0A 1JLCB 2WTFA 2VC1A 2W4DA 4CYUA 1OQ6A 4FXVA 1BXNA 4QIVA 3LWLA 1M5OC 2E5LJ 4JI0J 1WKKA 1RBAA 5KFSA 1N5SA 4Y00A 4DU8A 1MNEA 3LALA 5DDPC 5GAGI 2XZTB 5C24A 4QYZJ 3LF0A 5CA5A 5LJ5Y 1KTVA 2KT5A 2MDAA 3AHPA 4N8OA 4DFKA 4USJC 1J27A 2W7AA 3IR5B 4KB7A 2EBEA 5F8LA 4WPAA 5GVQA 2CWKA 3M30B 1F60B 1U24A 2ZH2A 4NMLA 1LNQA 1N5YA 5DG8A 2B5JB 1NJZA 1KTQA 2CJQA 2R7UA 4F36A 3GV7B 2E7XA 4JP8A 2YQ3A 4KC5A 5FJ4A 3D7SB 2WOMB 3CDAA 5LSOA 1S0OA 1HYSA 2ACYA 2IAJA 2ROPA 1KDNA 2VBYA 3I5CA 1CS4B 4ZLNA 1ICEB 4MIWA 2AV5A 2R3VA 3J81j 1S7IA 3DLKB 3W1YC 3PO4A 1R7IA 3HSDA 3Q83A 5F3TA 4B9VA 2R42A 1DTTA 4TYAA 2HK3A 3THVA 1NH7A 3EGWB 1FJ7A 1AFIA 2XNRA 1EAYC 4CIOA 1C0UA 2R8KA 6FDRA 3LW5C 3J81Y 1IKXB 5D4PA 5THWA 2VIHA 1TKXB 2QMUB 3THPA 4K4TA 4LF7J 4ZCIA 4PPZA 3MECA 4OX6A 5CCMA 2BRLA 3PX6A 1UAWA 5IT9Y 2C2NA 2HHHF 4I56A 3T19A 1YJVA 3BBCA 1FVSA 3DNCA 3B54A 4OJ3A 3EYZA 3UO0A 4GVLA 1UW4A 2W8LA 1IKWB 1Y3JA 4IH7A 2XYHB 2FJEB 1RT4B 1RT2A 1JNZB 2HNDA 3H0PA 1U0HB 2KXHA 3MI7X 3PW5A 2A2CA 2NXJA 2ROEA 2ZNZA 3FBFA 7AT1B 2XO6A 3EGZA 1MWQA 3KUHA 4P2MA 1WHXA 1Y3KA 3JTNA 5D3GB 3RBZA 4LUBA 1IR0A 5A0YB 5KFJA 3LP2A 5IT0A 4NXMF 1BQNB 3RB4A 2G0CA 1WJ9A 2HURA 2OPRA 1P9YA 4WTYA 3J7A1 2VDHA 3KK3B 4UUWA 1WF1A 2YX4A 3I56S 2YKMB 3M9OB 3M2RB 2OELA 1V3SA 1JLGB 1QSYA 1ZH5A 1NZ8A 2BW7A 2V8PA 3N6NA 1U1MA 3OHAA 1ZETA 1NSQA 4CLUA 2IIHA 3GV8B 1LWEB 4C3MA 4DF8A 2Y3YA 3VALA 1VRUA 3GZ7A 2QSWA 1BC6A 1NEEA 4HH1A 5D4LA 3IGVA 1TUVA 5FD1A 5K9FA 4C98A 3RB6A 2OEKA 3I31A 3VR1A 1RLDA 4B3RJ 1M1HA 2RRBA 4FYWB 4CLZA 4PWDB 3LGNA 2LEAA 2GHVC 2QMXA 3HFVA 4ECTA 2GVZB 1LW0B 4A4JA 3CB4A 2FY8A 1JXEA 5E3AA 2PO4A 4AQYF 1N34F 3OR2A 3TZWA 3CJTA 3FRZA 4CLKA 3R97A 3M8RA 2JFDA 4XTTA 3HK2A 3KMQA 4B3MF 1NH8A 1S1XB 5FIIA 1RKJA 3B4MA 1FKAF 1BWEA 1VQSA 3CXCR 2L3MA 3KUGA 2K2PA 1P27B 4TY8A 4I2PB 1IKYA 1G3OA 1LKZA 2K7KA 1T9YA 3H98A 5J2NB 1V3RA 3GIIA 1DY3A 2JLGA 4QJVA 1ZA1B 3BGLA 2NSCA 3W5XA 4N8NA 1D1UA 3VF0B 5LMUJ 5KFZA 4QWCA 2E1CA 2VA2A 2I38A 1UVIA 2MZTA 1SQFA 4I7FA 1Q8IA 2D3O1 1Q7YT 4A8OA 4LIWA 4ZPWR 1T03A 1YRTA 2LP4A 2KYZA 2BKNA 4DX7A 2ZJPQ 2ZUGA 2A18A 3CC7S 3PZPA 1VK8A 4HTIA 1TL7B 4LSZB 4IOCQ 5J2MA 3ZTRA 5CZXA 4P10A 1ZA2B 1VRUB 1N52B 1NPPA 2C1EB 3DRRA 1FD2A 4JI6F 2QL7B 4RR5A 1VQLS 2J8SA 5DM6Q 3KLIA 1GX5A 2BZ2A 2D9OA 4J90A 2FJBB 4OQJA 1YWXA 3GJSB 5E3QA 3N5FA 1FXDA 2EI5A 3KJVA 3MURP 4DSKA 2DVIA 2RUSA 4H4OB 3FBBA 1NJXA 4LF9F 1HQUB 1C0TA 4NRTA 1VYAA 4DPUA 5T14A 3W3SA 2GMJA 2VFVA 3J7Z5 2QLBB 3N5BA 3KJQB 4J9VA 1U45A 1UMJA 3TQ1A 3KLHB 1KD1T 4MFBB 4PG6A 1CJUA 1N0VC 2KHDA 1HQEB 2BJ9A 1EARA 1WC1A 3OD2A 4P2FA 2DHSA 4PR6A 4Q43A 3GG0A 1D3WA 3SQOP 3CD6S 3CO9A 4J91A 3T1HF 2M4MA 4TLQA 2AYEA 2VOOA 3AQOA 3HHKA 1YSJA 1LK7A 2YH0A 4EEYA 5K14A 2UU9J 4DLEA 2Q79A 4J9LA 1VISA 2R8JA 3K58A 4HLBA 3BS9A 5I3PA 2R7OA 1RTHA 3W8PA 4OHXA 5GAEU 1NKBA 1L5UA 3ILOA 4PQUA 2DITA 4I6YA 2G2ZA 2HK2A 2V5HG 1V9OA 4LFCJ 4LF1A 3HHLB 4AQYJ 1VQ5S 5C2CA 1UZHA 3CCLS 2D69A 3PM9A 4HVZA 3RAMA 3AB2B 5AE1A 2ILYA 5B7WA 2OMLA 2PC6A 3LAKA 4IG3B 4URSA 2M52A 4RW9A 1GT8A 3N28A 1VHFA 1HQUA 4G65A 3GPAA 2HRYA 5AXMA 1U0SA 3DN9A 3K0JA 1AZSB 2P5VA 3M6XA 3QFWA 3W9IA 1R0AA 5J2QB 3UDVA 5HL7Q 2VJVA 4Y2IA 3IS9B 3MM9B 1OS5A 4CLWA 1FX2A 3OR1A 1NKCA 1IBMF 3KNAA 1S9FA 1DZ5A 4LRFA 2D74B 4R0JA 1HWKA 3LP1A 2DNPA 1M1KT 2MQ8A 1T02A 2FD2A 4I6AA 5IOLA 4USHA 2L9NA 1WC4A 3SDEB 1W2IA 4JUZA 5L1JA 2VONA 1HNIB 4QU7A 4DPWA 3T5JA 2IM0A 2Z2LA 3UN5A 3DLBA 3Q8RB 1KHVA 3T1HJ 2GX8A 1X0FA 2DRDA 3JSRA 4M5HA 2ZBCA 3HFKA 8ATCB 3PIPQ 4A8MP 5SUHA 3PHTA 1OIAA 4ATNA 4JI8J 1Z2LA 4KFBB 3I6PA 4C2MA 5DG7A 1TKTB 4NX9A 3DGPA 1T9TA 1Y00A 2OD4A 2PIIA 3DRYA 3W66A 4UT4A 3ZZOA 4ALZA 1N32F 4PABA 4A8QA 1DQ8A 2V2ZA 3EUNA 5AJ3J 4WCEQ 4ZVSB 4P73A 1QAJA 4HI1A 2HVZA 3SV3A 1BHNA 3KK2A 1C1BB 2FTRA 5IZHA 3C14A 3MEGB 5B0AA 4CH0S 2CADA 4DUTA 2JEGA 1LOUA 3MDFA 2BVZA 4OX7A 1RKIA 2J7UA 2BUNA 3AA8A 4DV3J 3R2CJ 2AJ2A 1WTFA 1G7CB 4C0OC 3C46A 5EGYA 2CNKB 2B7CB 1HBUB 3TZYA 2IC3A 3EDRB 2LCWA 2DB1A 2GHPA 2YNHB 4TLRA 2DNYA 3DM2A 4XDCA 3U02A 4F7VA 2N4DA 2Q3PA 2ZD1B 3OTCA 3P5TL 1MU2A 1L3VA 4B9MA 4O3SA 2GVDB 4LMZA 3JSMA 2CZ9A 4RO0A 5KT7A 4ILRA 2CA9A 4I64A 2EFNA 3DFEA 2V8DA 4PG8A 4JI4F 2CNNB 1SIZA 5CABA 2LMIA 4DV1J 2ATLA 4X4VA 1VGYA 4ZJQA 3UCUP 1ZYQA 3OHBA 3M2UA 3EGVA 2MKHA 1YGYA 4DL3A 4IRDA 3QSYB 1I51B 1NLKL 5K8PA 5E41A 4CT9A 2FJDB 2OPPB 3T5KA 2GCFA 5KT6A 3QJJA 2CQBA 4DV0J 3JSYA 3NY0A 3MD3A 5HVHA 3T5HA 5CAAA 1KQGB 2EBGA 4FN5A 2EKNA 4KHPF 4MK8A 5HQ8A 2W7PA 5DZ7A 4K5RA 2QL5B 4J9PA 1PO6A 1N33J 2KFNA 1KOOA 2B9XA 2BANB 3D3CJ 4CH7A 4QPXA 3VAMA 4ZLPA 3HHLC 4ERDA 2BOAA 1REVB 3VGUA 4HHUA 4YDXA 9RUBA 4TQSA 2CQ4A 4F0HA 2GIQA 2GC8A 2YNGB 2Z58B 2EC2A 1G2EA 3S8SA 3H4BA 2J5AA 3H5XA 1F9FA 2XMKA 3O1LA 3U1MA 1G6BA 2KI2A 2VPZB 2Y8YA 1NMEB 3I0RB 3EZUA 1EKSA 3SXLA 3G2XA 1KC8T 4LFBJ 2JX2A 2H48B 3IG1B 3E01B 1GXLA 4NCGB 2PMHA 4YEAA 1XR5A 3JAMU 3RU0A 1WEXA 5K5MA 5T7LA 4ELVA 2ZBPA 3JQJA 5KG7A 3BSNA 2IBKA 5D0HA 3M32B 1CJVB 1X5TA 2P6TA 3DXBA 1JJ4A 2YNIB 2V8VA 3IAM9 2B4VA 1SJRA 1H7XA 4GC7A 2JLEA 2QYCA 3N6LA 5HVGA 3H7HB 4DV2J 2PI4A 4OHWA 1GH8A 1VRQC 4M5JA 3OL9A 1AYEA 3HKWA 4CRJA 1TV6A 3MMCB 4UZCA 4MJKA 2EXUA 4KHRA 1NK4A 3X1LB 3PRDA 3M9NB 1FWPA 5L8RC 1HR0F 4YUDA 1SC1B 2GMLA 1N54B 1S6QA 1SH2A 4OZ0A 5AE3A 2P9GA 1ZAVA 3NOGA 4NLUA 1S1VB 3DRRB 5GADI 2H5EA 1CJKA 1QSLA 2WVCA 5H9EK 5F0UA 1LXJA 4ZITA 4OI2A 2HMIB 1B4SA 4F0MA 2VJUA 5CYJA 2VG5B 1EQ0A 2K1RA 3IXQA 2MY8A 3W61A 3FQLA 2MQQA 2NXEA 4C8MA 4YR2A 3MR7A 1WEZA 2BV3A 3HVRA 2NR0A 1RSCA 2HNZA 2ZNYA 3CW2C 3DRSB 3GFHA 4RX6A 5LM7E 5A76A 2UVUA 1RAEB 3D1QA 3NCRA 1HBMA 3NS7B 4LR7A 1F5CA 5ETMA 2P9CA 3NS5A 5HP1A 4AT1B 1U4BA 4MMOA 3M4XA 2XCAA 3SSRA 4ZOSA 4I1TA 1RYSA 1OSCA 3VHQA 3SV4A 2FB0A 2HLTA 5DGBA 4LF9J 2YQ0A 3EDQB 1QSSA 2XI2A 2HNYA 3MUMP 2W9AA 2MYFA 3JXOA 4ZVOB 4X66J 2K7JA 1MW7A 2W2NP 4S0MA 3MAQA 3WBZA 2B5JA 2RILA 2WSFC 3SIPB 2CPEA 3EZ5A 3CUNA 4Z7CA 2KN4A 1FE4A 2DR6A 3FQKA 2DKOB 2AYBA 4ZJOA 3IC1A 4F4XA 1YJ7A 2CJAA 3R5AA 1HA1A 3KDNA 4KV8A 1PJ6A 4DXLA 2DISA 2HBYB 3QPIA 3ENQA 3UD4P 3D3BJ 3PV8A 1YJNS 4EZ6A 4YMEA 5KFLA 4OYIA 1CQMA 2QO3A 1NSAA 1GAOA 3BKUA 4PXDA 2B4OA 3Q2TC 2VBWA 2CYYA 3OW2R 2DR8A 3LWMA 3K5LA 1X4EA 5KT2A 2FLPA 5F8JA 5AT1B 4C8LA 1NNDA 3DLGB 5IS2A 2R7TA 1DTQB 1RTIA 1GX6A 2AIRB 3DLJA 1B0VA 3OFEA 3OXGA 4QW9A 4F4WA 4JI5J 2RVJA 1IBCB 2CZVC 1PGZA 2ZEJA 4OJGA 4WYLA 3QRPA 3U1NA 1UEUA 3KFWX 3HSJA 4V1Ak 4JI7J 1QAXA 2DBBA 2E29A 5E33A 4R8UB 4FF4A 1JWWA 2A3JA 3POTB 3UDCA 4DL5A 3FEZA 2JEIA 5CD4A 3BDEA 2NSBA 2WW8A 3TO8A 1VFJA 4YHHJ 2JDJA 2BW2A 3IM9A 3RAXA 1W2BR 2LXIA 2V4JA 4YR0A 1ACMB 2F4VF 1ZOTA 1WDTA 4H4MA 2FJVA 3GV5B 2J7KA 4QWBA 4B9SA 3UW1A 4JI1F 4RW6A 4B9LA 3BO3A 2F1FA 2RT3A 5GMDA 1SC4B 4ZCMA 4JI2F 3FFIA 1Q81T 2DR9A 3QIDA 2FHJA 2QZ8A 2CXEA 2C2KB 4XO0A 4OV6A 2XSJB 1Q95G 4DS4A 1QE1B 2IJNA 1WKJA 3E3XA 1ZPWX 3LOUA 3D6MB 1WHVA 4J9SA 4LF2A 5HI7A 1Z2ZA 4KFBA 2C28A 3QJPA 1RTJA 2MLYA 1CJTB 5B0FA 1QAIA 3CJ3A 4F2RA 1X4FA 2QE5A 3WX8A 4L6V3 1H38A 2GA7A 1TL3A 1S1TA 2DNGA 4P2SA 1H7WA 2IMOA 2QLWA 2WSEC 3D6TB 4LRAA 1GMUA 4NEYA 3RYLA 5HMZA 3PX4A 1EP4B 2DR7A 4WP8A 2RAQA 3C15A 1U1KA 1RWVB 5IT9U 1NDLA 5J2PB 1TL1B 4CWBA 1PYOB 2LEBA 5HROB 3CIZA 4NYZA 2NQPA 3IM8A 1WEYA 2NUHA 2VASA 3EWGA 2KRBA 2N3LA 3VGSA 3H59A 1X4BA 2JRSA 2JL9A 2MZ1A 3KUEA 2XMTA 1GEHA 5F8MA 5C25B 2D3UA 4LF6F 1FI4A 4V19X 3B78A 3RW6A 1U2FA 4IQXA 1U02A 2QT7A 2RHSB 3KHLA 2V4JB 5BYQA 2HHHJ 4OHVA 4DOZA 3OUYA 4WIQA 1Z4UA 5K14B 2E5GA 2G4BA 2VHGA 1BE4A 2CVIA 2J76E 3BSOA 5H9EJ 4PUOB 4X64F 4QWDA 3QT5A 1UCNA 2QMWA 2BBEA 3FDSA 5EX0A 3VTIA 1F1BB 2RE1A 4ZPBA 2A2DA 1X4CA 3AODA 3MHYA 3JQMA 1ROFA 5KFVA 2R7RA 3ENVA 4RJVA 2ZM6F 5DM7Q 3C2PA 4H4KC 1RBOB 4FF1A 1FFSB 1TZ0A 2ZITA 3FZBA 4QIEA 3OT9A 2HFOA 4RBUA 2ZM6J 3VAJA 4C8ZA 1YJUA 1BMQB 3H2VE 3C66A 2DHAA 1C2PA 2KB2A 3M8YA 1WDDA 3CDBA 2KM8C 4WYWA 3KLIB 3CCJS 3DGVA 3R27A 2XS2A 3N9UC 3AB4B 2DYAA 5A2QY 4G1PA 1RCXB 1VBKA 3THTA 1CLFA 3DMJA 1NB7A 2GMHA 2YNHA 4J9QA 1REVA 3QRQA 1SH3A 5J1EB 3IP0A 1CVJA 2ZKUA 3TA0A 3R5GA 4Y2CA 3D28A 4ZVHA 4ZPTR 4CH1A 2K3KA 3FJ2A 1KOHA 3Q8SB 1U1RA 1NK7A 4O44B 2V9KA 4O3RA 4K4SA 4FYVB 3OQ2A 1KLMB 2B51A 1I94F 4Y6IA 2EVZA 5A8RA 5IV4A 4F8RA 3SCLE 2W9BB 4CLYA 2CDRB 3CCES 1SUQA 5A0YA 3P6YC 1BD6A 3BM7A 4LR8A 3ICLA 1BQNA 3MMAB 3OBIA 4W98A 3TJAA 1H6KX 4P74A 2YNIA 1TK0A 3G9CA 3ZZPA 2CQ3A 2XMJA 1F5AA 4F0KA 4EMDA 2ILZA 5HMYA 1F5BA 1PSDA 2DY9A 2IAJB 4C7QA 1X0PA 1NHUA 2GV1A 3S7RA 7FD1A 4FKXA 2MEWA 3CDWA 2DIVA 1RWPB 5KT3A 2CJKA 4ZVGA 3CCMS 4WK3A 2UV8A 1HWJA 4XPEA 4ES1A 3ETOA 1UA0A 1FXRA 2YKPA 3IRXB 3M2VA 4PWDA 5C24B 4HYKA 1CULB 3VAGA 1C1BA 3ELHA 1LW0A 3QIPA 2HIYA 2J9EA 4OJHA 3P96A 2RKIA 2FJAB 1X5SA 1QY7A 2KG1A 1A6LA 2G2YA 3WX4A 1Y9OA 3QLHB 3A12A 5L1LA 3AXKA 2OFGX 1R0AB 4A8FA 2QYGA 2H4WB 2VD3A 2F4FA 2F7VA 2WOMA 3DM2B 3FUYA 4TY9A 2HNDB 3Q8PB 4CO0A 1CS4A 1JXVA 3VZHA 3UVJB 4O3PA 1B0TA 1S9GA 3KDOA 1AA1B 2X1GA 4GRSA 1FEHA 1JLAA 2VG7B 4YB6A 5D3GA 1T9XA 1YBTA 3W65A 2BEFA 3MM8B 3PRBA 4G1QB 3BKTA 4NLSA 4ZPDA 3R1HA 1T9VA 1FD8A 1H2UX 2W25A 4DCOB 2J9DE 3PHEA 1XERA 1OPZA 2F65A 1SQEA 2XSFA 4Y3CA 1HD1A 1MN7A 1W25A 2KHCA 2OD6A 1HNWJ 3RUBL 4Y65A 1FA0A 3BO2A 3H25A 4IFVB 3V81A 2FC8A 2FGOA 2J0WA 2HQCA 3H5YA 1H98A 1LFWA 4FVCA 3RW7A 2DR5A 5J2QA 3J7AN 1SXLA 2X1BA 2B3TB 4ED8A 3TAQA 4W90B 4WF9Q 2YWGA 2OKQA 4OYBA 2C2OB 3KYLA 2MKIA 3L9ZA 3UCZP 1C4CA 4EU0A 1IQZA 1VJWA 5AJ3F 1ZTTA 1QD1A 4F04B 4JOUA 3K17A 3UR0A 1HNXF 2Z2YB 1N5TA 3FZ2A 2B8PA 2LKZA 3FBEA 5HVFA 3KKFA 5AXLA 3OVAA 2DRAA 1S4EA 3G82A 3KLEA 1KWMA 1Q7LB 1X4DA 4R25A 4LJMA 1R27B 1ZPVA 2F40A 2GIFA 4X62J 1NK5A 3MEEA 4P75A 4ZA1A 5DDRC 2OPRB 2XQCA 3NAIA 3UN3A 4NWBA 2VU5A 1SQGA 3SFGA 1VBZA 1DARA 1N36J 1C4AA 5B0DA 3HVWA 2HHSA 4Q2MA 3Q8UA 4DV7F 2MLZA 5ETPA 3D66A 3TANA 2LDIA 1B64A 5CYQA 5DG9A 2XNQA 4MT1A 1U48A 4Q8EA 2E9TA 4DR2F 3L4BC 4P7TA 2HG4A 5IC4B 4IH6A 4JI2J 1F3FA 3I0SB 1B7FA 2XSJA 3FBCA 4H4OA 4J9RA 4DU7A 2XG8A 2M0GB 3QFHA 1U8WA 2DJWA 5LMNF 4IO9Q 1ITPA 3HKZD 2O5DA 5KFGA 2E1MC 2OPQB 2W4CA 1RBLA 1HPZA 1U7LA 3QZ8A 1KP6A 3CT9A 3QQCD 4FVMA 2OO4A 4B3SJ 3GFZA 1SL0A 1FJEB 4DLGA 2OH2A 3CDEA 4U8VA 1VK3A 3C19A 3W7BA 1NDPA 2WONB 1FO1A 4KKOA 2YTCA 2HNZB 3P8BB 5KFOA 5J2NA 4WZMA 3PJ9A 3KJVB 2DO4A 4YB5A 1FWLA 1S6OA 2B6AA 1VI7A 1PAUB 3I96A 1RAHB 3EVMA 2UUCJ 3CJQA 4UZBA 3UN2A 1R43A 3I32A 1VQYA 4YY3F 3CWJA 4I7FB 3RJMB 2HZVA 3QRRA 4WKRA 3HFZB 2O01C 2YWFA 3LGHA 3HPOA 1XNQF 5LL6d 1Q5YA 2DHGA 3BPSP 3TJ9A 1DLOB 5B0BA 3KLHA 4F3OA 1ZZNA 2ROGA 2Y1LB 2Z2ZA 3SZ2A 4C0BA 3GWCA 2BE2B 3HHLD 2VPWB 3W2WA 1T8EA 1M0SA 3OL7A 1AT1B 3NCPA 2HBQB 1TKZB 2APOA 2E44A 1TQLA 5B0EA 4BC9A 1FRIA 5L39A 2QA4G 1APSA 4CM0A 2HZAA 1YBAA 4LBIA 2VQFF 4EBDA 2FVQA 4XK8C 1JIHA 4NLTA 1Y10A 2F9DA 2HGNA 4F2SA 5HN0A 5HBMA 5D0RA 4YS2A 1WORA 1TL1A 3R1LA 2EEYA 2HWHA 5HLFB 3I55S 2G0IA 5I42A 3WDOA 1Q0NA 5ETLA 4JYAJ 3FRYA 2FC9A 3MF5A 1R3NA 2V34A 3CJKA 4WKYA 3CPWR 1S0VA 4USWA 5D6GA 3PW2A 1G4CA 4DR3J 3CULA 4ED1A 2GVZA 3DHWC 2HMIA 4IO1A 3MCSA 4Q45A 3DOLB 4MFBA 3A4TA 2YWHA 2GGPA 2RQKA 2KH9A 3I9V9 4DL4A 2X1AA 1VCTA 2O1PA 4CTAA 5A8WA 4QBUA 1XWLA 2FLNA 2HS3A 3RBEA 1XR6A 2AJ4A 3KK1A 3TWZA 1TELA 5M2UA 3OV7A 3H40A 2IY5B 1UJ6A 4ZCLA 3HZEA 3HHNB 2MZSA 4NLDA 4R5PB 3MR5A 4M63A 1RU1A 3R5BA 2GVDA 1YDLA 3AD7C 4ENOA 2CQDA 2H51B 2JFKA 4LBPA 3X3UA 1U8SA 2AX0A 4O3QA 4MTPA 4OYXA 1AUDA 3PYEA 1TAQA 3GR0A 2LA6A 1OMSA 2V2VA 3NWRA 1QVGR 3CJ8A 2MMYA 1MSWD 3TUIC 1P1LA 1WD6A 4DV1F 2DNKA 3QATA 1H72C 1X7VA 2ZZTA 3JTPA 3M2UB 5H9FJ 2DCUB 5LSRA 2DGOA 3C6UA 1HD0A 3CGIA 4ER8A 1G1XA 4PXBA 2NUUG 1T0TV 1FNXH 2CVEA 4WU2A 5F0WA 2QSFA 4N7TA 3Q8QB 3U7JA 2R2SA 1YJTA 4RWXA 1TMJA 3ETMA 4P71A 4WU3A 3QT7A 1BUXA 1HHTP 1MROA 1S1XA 2MKYA 3UD5A 5A8KA 1U2CA 2UZAA 5EWFA 4EYHB 2QN6B 3VV2B 4LQ3A 4JI1J 1GXTA 2BANA 4AYBD 2HFUA 2Q6BA 3D9BA 3ZZ0A 2DGXA 4PXEA 2FUG9 2DNRA 2XMVA 4H4KA 4OYPA 5HMXA 1EJ7L 4USTA 2ZH8A 4DR5F 4KHMA 3ET6B 2RDIA 3DOLA 3CJ2A 3W2VB 2RU9A 2UXCF 1N5QA 1RI7A 1YJWS 3C14B 1X4GA 3MEGA 4DHVA 1UVJA 4NRUA 4RNMA 2KG0A 2HFVA 2ZH9A 2L48A 5L1KA 3PY8A 4NZ6A 3GIJA 1T03B 1WC5A 3E01A 4ED7A 2Y1IA 1JLQB 2V9WA 1CBKA 1LQ9A 4O0IA 1E6VA 1FDNA 1RAOA 2RS8A 3Q89A 3MEKA 4DV0F 4Q44A 1ZAWA 2B9EA 2AMCB 2I5JA 2MQLA 3AJDA 2DXEA 3M2RA 1HW8A 4ZVRB 4ZVFA 1R0CB 4E0DA 3JSBA 5KTQA 2F63A 4ECRA 3SBMA 4C48A 1UTAA 2KFZA 3MXHP 2HQDA 2JSXA 3GSDA 3MM8A 4G1QA 3HXMA 2ZJQQ 1KS2A 2IM3A 4F50A 4QWAA 1KRPA 3QYYA 4ZLJA 1OY9A 2IYGA 1JLBB 3H5SA 3I4HX 3F0NA 5KFWA 3IBWA 3ISNC 5HMWA 1UWAA 2ADCA 5JUMA 1BLUA 1MMLA 3CEDA 5IC6B 1EETB 1VIXA 3EJMA 1Y5IB 2C2DA 4KSEB 3I0RA 1PC5A 1ZZFA 1CJTA 3PG9A 4OZ1A 1HWUA 3AA9A 1HLWA 4YFUA 2MXYA 4LF8J 2NS1B 3F56A 4QR1A 1CJUB 5U47A 2W8KA 4DV4J 4JV5J 4NLXA 1QUPA 1J5OB 1XMOJ 3QGGA 3IO1A 1NJWA 1HBUA 2MQOA 2CUYA 1ELOA 3T6BA 1IWGA 5E5NA 3ZTOA 5JVGQ 1VQ9S 2DGVA 4L3NA 4DV6F 4OX9J 3GYXB 5KFNA 1LWCA 1IM6A 1YLXA 2PFDA 3V5RA 3RAQA 2RF2A 1NU4A 1URNA 4OI6A 2JHEA 4OZ2A 4WXOA 1N8RT 3IWLA 2HAFA 2VOPA 5A6WA 3I87A 1TK8A 1SPBP 2Z30B 2UUAF 5FLXU 4FS2A 2V2KA 4WJBA 3B8HA 2OSQA 4EZ9A 2PT0A 2CG4A 2DXFA 1DHMA 3NGDA 2J0QD 4WTOB 2XEXA 1SKSA 3HHDA 2Z56B 5GMKa 3SDEA 4ZP6A 4LF5J 1CJKB 3L09A 4OX8A 4C6AA 3PVXA 2AD9A 1UFLA 4IOBA 1IBKJ 1I1GA 4ELTA 1KFDA 1RAFB 2LU1A 4WWSA 2ZZMA 4DR4F 3KK3A 3MAHA 2FHMA 3TVKA 3G4SS 4KIAA 4UOHA 3BB5A 4QIFA 4DV2F 1X31C 4RW4A 1OSDA 1RU2A 1RAAB 1V6HA 2XZDB 4K2XA 2P9EA 2RDJA 2J6UA 1Q16B 2Y0SD 2RRNA 4WE1A 2HLUA 3OL6A 2OAUA 4GKKF 2DHHA 4NYOA 1OYEA 3QIPB 4C8NA 1B3TA 1VQ6S 1VMBA 1Q8LA 1K9MT 2IJRA 4PG4A 4RWWA 4DR6J 2HHVA 2RQ4A 3TEGA 2PA3A 3EXYA 2M7SA 5KG0A 1VRTB 4N5SA 3D0IE 2ZH5A 1UPMB 2C22A 1IBLJ 1SC6A 2HQ3A 2LECA 1Y7PA 4KQZA 4M8LA 1UEVA 2UV8G 5KOWA 4LSLB 1HNIA 2R9LA 1RXOB 5GAEI 3GJRB 2QA2A 2CDQA 6FD1A 1A0OB 3R3TA 4A48A 2IBOA 4Z7YA 5KG1A 2XLIA 2R2UA 1WC0A 5M2RA 4IRKA 4TVAB 4UW2A 2MHNA 4M5IA 3TAMB 1MU2B 1RWOB 3SCKE 1XNQJ 2B43A 2BMBA 3FCWA 5BYSA 1QJHA 1DBDA 3IR7B 3KNGA 1NPKA 1LK5A 1WG5A 2OTJS 3VWSA 2XO7A 1DURA 1VQPS 3WHIA 5KG3A 1W7WA 1SV5B 2VDIA 3W8GA 3NXZA 1OY6A 4JV0A 4DSJA 4ZPAA 2IRYA 1QE1A 2ABYA 5E3CA 4B9NA 3EVOA 3G87A 3UR3C 3VQTA 2CQIA 2FZGB 2ZH6A 2QLJB 5M2PA 3DRXA 4P52A 2AP6A 5DLFA 2AJFE 4WE1B 4NLVA 1PCAA 4USIA 4Y2AA 1ULRA 1XBWA 4TXSA 3EGNA 4O3OA 1Q4RA 4ZVQB 2B6AB 3PXGa 5GMEA 2RS2A 1SIWB 4RBVA 3BKFA 2FY1A 4O44A 3V2UC 2W9CB 2IVYA 4IDKB 2BJ8A 4KGKA 2CPXA 2BM1A 1HKAA 2VV5A 2OEJA 4W4MA 4I67A 3L7PA 1GK8A 2FVSA 3T9NA 2YWKA 1HBNB 1X4AA 1HMVA 2FHKA 4DFPA 3MUTP 1F2GA 4OI1A 4ED5A 2MSTA 2FQQB 1BQMB 3KG4A 2MGZA 4K4XA 4LVOP 3VVUA 5LXRA 1NCLA 2M8HA 1EHWA 3QLHA 1IBLF 2F3JA 2CPYA 3VGTA 1A9NB 1R8BA 1S76D 3OXFA 4FP9A 1L3KA 1T11A 1DAXA 3FK4A 4QZVB 1GMWA 3V6DB 2PGCA 3Q2SC 4X4RA 2NYHA 1DQAA 5KFBA 2BE9B 2ZH3A 3KTQA 2G9OA 2V94A 5CYQB 3UD3P 4N76A 4DSEA 1N32J 2R7SA 4QU6A 1X9SA 1JNRB 2L9DA 5KG6A 1S4FA 3DYAB 2J9CA 2NZCA 4HTJA 4GKKJ 4MK9A 1MWZA 2XMUA 2MJUA 3FGVA 5D15A 2HRUA 1U1LA 1SKWA 2RQCA 1S72S 2A1BA 2NXUA 2RH3A 4HEA9 2GJIA 2RHQB 3C8YA 1YHQS 3GP9A 3MOJB 3NP5A 3MM5A 2PMWA 3C16B 3NNCA 3BH7B 2MB0B 4JI7F 1RT6B 2YBVA 4TKTA 2HVHA 5C25A 2ACMA 3GLJA 2B0GA 3NKYA 1EKRA 1RWXB 2BABA 4A46A 5DQHA 3HCXA 1UKUA 1JXLA 4RU9A 1TL4A 1FRMA 3R6GB 2KVQE 3TVYA 2F8EX 4UTGA 2XI3A 4OMFG 4OZ3A 1KQKA 1CJVA 3QGPA 4ID8A 4KGZB 5CD4H 4DV7J 1FDAA 2I1RA 2CQGA 2XBPA 3PFOA 5DZ6A 5BR8F 2Z2MA 4CO1A 3JSMB 2O67A 3MPUB 5JMNA 3CVKA 4LREA 1S57A 3ZZTA 2HHWA 4M5DB 3G96A 1H0HB 4X4QA 3HSZA 2L9WA 1RT1A 3W2WB 1XIQA 1SL2A 4NE9C 4C4WA 3QAUA 3DI6A 2LEPA 5KFCA 2U2FA 3QZ7A 1S1VA 1FRHA 1N34J 5L9NA 1M5SA 2D1CA 4IFVA 3V81B 2XLKA 2MZJA 2VH7A 2FVPA 1XQIA 3FNNA 1PYSB 4LF4J 2M2BA 1Y5LB 2VG5A 4KPYA 4ZHRB 5HLFA 3ZTPA 2ZFHA 1JK9B 2CNLB 1SJQA 5E3PA 4ANEA 1P9QC 2P8IA 2XGPA 1JJHA 2MLXA 2QJ3A 4HT5A 4ECVA 2BYCA 4WP9A 2R8HA 1Q1KA 1GTHA 4EO8A 1VHIA 2YY3A 2ZOMA 3R5DA 2YNGA 2AHOB 3NCQA 2CG8A 4HR2A 5IV3A 1T95A 1NUEA 1RTIB 5F8IA 4K4VA 1UVMA 2QFIA 4YY3J 3LP0A 3CCRS 3GMGA 2HRTA 1JLQA 2DGQA 2H3EB 2LYVA 3T3FA 1TK5A 2DRBA 4X2BA 1OWXA 1WOPA 5BJRA 3K7RA 1S49A 2I5JB 1BY9A 4KE5A 3J80U 4FF2A 4MIAA 2DH7A 4HI2A 4ZN3A 2CJBA 1TUGB 2WBMA 1JJ2R 1FERA 3MPDA 2I2YA 2PEHA 2GAGC 3A13A 3NGKA 1I3OB 4KAIA 5HQLA 3V4IA 4IQMA 3ZTQA 4U95A 1FVQA 5KFKA 4G6VB 3NBPB 4USKA 1HQ2A 1R8CA 3KJFB 3UCGA 3G6XA 1I5OB 4GO7X 5CQGA 1UW9A 4ZP9A 4J9NA 1T3OA 1Z1ZA 2FGCA 4WK1A 5F8GA 2YKNA 4M5GA 2KM8B 2YX1A 3M9MB 1ZM4A 3ONQA 3W64A 4PRFA 4CM2A 4U7CA 2XULA 3B6BA 4DJBA 2CPJA 4OLOA 2HZCA 4AXJA 4DV3F 3PR5B 2NYIA 4M5NA 3VCDA 3NGTA 1RZMA 4UQGA 4KBIA 4ES2A 4FF3A 3CC2S 4B08A 3OR2B 1O0PA 1AB8A 1S9EB 2PE8A 3OFFA 4KKOB 4P7VA 4OX9F 2VFRA 4ZIVA 2VQFJ 4DV6J 5DJBA 3Q8VA 1J5EF 4OI0A 1FRLA 1LWCB 2AT1B 1LXNA 2NXNA 3PDNA 4OIXA 1HBOB 4TNOA 4PG5A 1XMQF 2J7WA 3DRSA 5KT4A 3HF5A 3PW0A 1NK6A 2B4UA 2GHWA 2ZC4A 3ET6A 2D41A 3FVYA 1N33F 4B3TJ 1FNOA 4L75A 5KAKA 1Y5NB 5A8RB 2DT9A 1VIOA 2HKEA 2C3OA 1UVKA 2ASDA 1XNRJ 3B4DA 1GTEA 3GIMA 5KFMA 2GO9A 1M5HA 4FPIA 4DUZF 3HMJG 4RNOA 2DPIA 2GJFA 5D8HB 3LPEA 4DEZA 4ZJLA 4F02A 3G8TA 4ZP8A 3TA1A 1RWKB 1XJWB 3TA2A 3HHEA 3LA0A 3BQ2A 2DPJA 2W2QP 2YXLA 3ZTSA 4CO4A 1TUWA 3EICA 5CYMA 1RUSA 1R8AA 3A8JA 1LV5A 3UVJA 5KOXA 2COLA 4J9UE 3HSGA 1FT8A 4JBCA 1OO0B 4DQQA 1HW9A 2F4VJ 4ECXA 1D9DA 3AD9C 4YOEA 2E7VA 3MFHA 2ZHOA 3G8SA 2ZBIA 4PKDB 2YWEA 3DHXA 4DF4A 1NK9A 2UP1A 1RGVA 4OYZA 5DQIA 4WFYA 4DN9A 2UVRA 3CO0P 4TQRA 5HANA 4DSFA 4OI3A 3IBCB 4IH5A 4NI2B 1HNWF 1HBOA 3BEGB 5A8WB 4B02A 2EWHA 1S99A 1U6BA 1U09A 4K7QA 4ZLLA 4NOHA 5MLCV 1QTMA 2CAJA 1FKOB 3KLFA 4RKUC 4NZ0A 2V67A 3D68A 2E1RA 1T9WA 2JVOA 1FNMA 2N7YA 4C3LA 5JJBA 5DLGA 4ZPVR 1WSVA 3L7OA 4CQ1A 2HYIB 2WW4A 4O4GA 1S0NA 4DQPA 4C0HA 4RUBA 1RB0A 3C6TA 3A8EA 4PG7A 1HBNA 1R0BG 1ZM3A 2XMMA 3I5AA 3TOQA 3V6KA 2ASJA 1K1QA 4CZCA 4DSLA 1NHVA 2YX7A 2E66A 2V68A 5IWAJ 3HM9A 2AKWB 1KONA 4G3IA 1NO8A 4Q0BB 3QNWB 3PW7A 4DG1A 3JB9k 2YKMA 2DIUA 4NMXA 4CT8A 4J9OA 2ZHBA 2NLWA 2UUBJ 3HX9A 4USUA 3UPFA 1AROP 2OPQA 3R5CA 3JQKA 3SCJE 4NLYA 4UOCA 5E2QA 4K4UA 1VQMS 3G8QA 3N79A 5J1PA 2AJ0A 1K0VA 1RTJB 4L73A 1J2VA 3DLLQ 3IA0A 1H3DA 2A6MA 2DNZA 1RAGB 4RW4B 5B08A 3OTBA 1FKPB 2MQNA 3M8PB 2D3OR 1VDHA 2RNEA 3HI9A 3AY0A 4OZLA 1JLBA 1HHQA 5EWEA 2BACA 4W92B 2IDEA 3ISZA 2UUAJ 1KFSA 2CQ1A 3K59A 3VZIA 1JLFB 2VC0A 4TU8A 4KYZA 1R6YA 1CULA 1WG1A 5IWAF 3KLGA 1SCJB 2NPIA 1HNVA 4ID5B 3IS9A 2N7CA 3IN5A 2MKKA 4DV5F 2V63A 3CDUA 1FKOA 2P6SA 3KLFB 4D3GA 4TN2A 1VQKS 2LU2A 3WZ0A 5H9FK 3W5YA 1GFWB 3NOCA 4EK2A 1L3UA 1KVIA 1NHKL 4X65F 2V4QA 2Q6CA 4DV4F 3RBXA 4P2XA 5KG4A 2Q1LA 2H5JB 3GCWP 4BWJA 5GADU 2VICA 3TARA 3BV8A 3PJWA 2UXCJ 1CC7A 4CO2A 2UVVA 4B3TF 4X84A 3M7VA 1UVNA 4J37A 4KRWA 2B4PA 2WCXA 2MJNA 3OTOF 4DZDA 3Q8YA 1MLAA 4M5MA 3PW4A 4RU2A 1MMNA 3MEDA 2W4PA 1U26A 3QO9A 2KRRA 2FPHX 1PBUA 4LBHA 1SBRA 5D0EA 3TUJC 4HKQA 1U6FA 3P3DA 5IM0B 1IR2A 3CF5Q 2XY5A 2LXFA 1AW0A 2VZ9A 1Y11A 2RDDA 4I4BA 3ZZUA 3EE3A 2UUBF 4KO0B 1IQTA 1Q78A 2PDAA 5KFQA 1BWVA 2W2OP 2AWZA 4N56A 3BGRB 1NB2A 2WK4A 4FDFA 2R8IA 4DR1F 1K44A 4GO5X 3BR9A 3R9LA 4YDDB 3HVAA 1RISA 1MWYA 2BKPA 3BSCA 3QT6A 4CLSA 3JAMY 2AGOA 2YPYA 4DR1J 2M8DB 1TP7A 3I4PA 3NAHA 2CZ4A 3N01A 4NCBA 2AEJA 4WIIA 2LXUA 2WAQD 1RHUB 3D6HB 5FDLB 3Q24A 4A8YA 3T6JA 3GIKA 5I42B 3MR6A 4DQIA 2AZ1A 4C97A 1CG2A 2DNMA 2DHXA 1GMWD 1RTZA 2HS4A 2JC1A 2V69A 3UFCX 1RHJB 1SL1A 5LSLA 2UXDJ 4IYQA 2KU7A 3CD0A 3C15B 3OFHA 4M5DA 4U7UD 4DCJB 2GIRA 3MMBA 4Z37A 2HFSA 1F0XA 2R4FA 3FEXB 3H2UB 3UE2A 4YQWA 2Z8QA 2J6TA 4QQBA 3PCOB 3H8YA 2ADBA 3AT1B 3FC9A 1WI6A 3RRHA 1NSKL 5EDWA 2PN6A 4QIWD 3MTKA 3J7YU 5ETKA 1SKUB 2BQRA 1HYSB 1S6PA 2LQBA 4C8YA 5LOQA 3JYTB 3MOZA 4I0WA 3IR6B 2B7BB 2IRUA 1RT7B 3P45B 2DH8A 4ILLA 1JLEB 2RJZA 3TRGA 3KWMA 2Q66A 3HD2A 3QGIA 3CCQS 1RYRA 2ZZNA 3BH6B 5LJ3Y 2QTWA 1SI9A 4BS2A 2ASYA 1FHTA 1YRUA 4PWUA 1VBYA 2UUCF 5D77A 2ZBRA 4DR3F 4Q8FA 3R7BB 2M9KA 4X4TA 1TKXA 3E8OA 3O6QA 3W63A 3C6UB 2RU3A 4QR2A 2BJEA 3UDEA 1WELA 2XWXA 2OPSA 5JXSA 1RTDA 1VC5A 1U1NA 3M1VB 2H9ZA 2G2OA 4DN0A 3BGFA 2RRAA 3GJTB 2CPFA 1IN0A 2LFVA 3D0GE 4FBTA 3DOKB 3T1AA 2HHQA 2HFZA 2DEJA 3ZNUA 4CLLA 3MR3A 4M94A 4NXMJ 3CMAS 2KJVA 3QJLA 1YZ7A 2ZVIA 4MKBA 4BC7A 1YK9A 2DNHA 3L7UA 3LP1B 4TU9A 2L41A 4ZN1A 3O44A 3HT3A 4OZJA 2QFJA 1I94J 1EIYB 1KN6A 1H2VZ 4PAAA 2K06A 1F9EB 4WP3A 4JI3J 4LF4F 1JLAB 2VG7A 4DUZJ 3PYDA 3R7NB 2V8HA 1DRZA 4NLGA 2AJ1A 4OYWA 1WF0A 2D9PA 3IBFB 4LVNP 3ILIA 2MQPA 2RQMA 3ZZZA 3D2WA 2X7IA 3GR1A 2AZ3A 2QRRA 2NPFA 1S1UA 3K5MA 4DPYA 1RAJA 3T1YJ 2G13A 5EN1A 1S9EA 5IXUA 4DUYJ 2LDYA 4LF8F 3KHRA 4M5LA 3OTOJ 1RA6A 2J9DA 5G0RB 1U49A 4DUYF 4OZNA 4ED3A 3M8SA 3WC2A 1JLCA 1RADB 3L95X 1YTYA 4PWWA 3ISND 3QWUA 2GFFA 1J5EJ 1OPIA 2MKCA 5E7OB 3IGNA 2R2TA 1QVFR 4BWMA 4QOTA 2GNKA 1S12A 3D1OA 1S79A 3GU0A 2CQ0A 3NGRA 3US5A 4NLOA 3K8VA 4Y28C 3O5TB 4YR3A 3CJ5A 3ITHB 3LUYA 5A6PA 4ED0A 1DFDA 1XTZA 5HAOA 4OI4A 1FFWB 1HARA 5C7PA 4F3MA 1DJ0A 2GQ2A 3TX0A 4AL7A 5HJYA 2OSRA 1BQXA 2CQ2A 2VG6A 4DX6A 1EX8A 1VRTA 3TI0A 2FVCA 2XHCA 1WHYA 4TYBA 1X5PA 1YKWA 1FRJA 4EGLA 1YRXA 5K20B 2I0XA 2MTLA 4O4GB 5BYRA 4CTAB 5EHHA 2BX6A 3MAAB 1LFPA 4DPXA 3VAKA 2C2MB 2RB7A 4O4RA 2KTQA 4EWTA 5KFTA 1N0UA 2XMAA 4MIBA 3OLBA 3PFEA 3ULHA 1FK9A 4LIRA 4K0KF 1Q53A 4A47A 1VOMA 1U6ZA 4UQTA 1HR0J 5ETRA 1TU0B 1SB6A 2OI2A 5HBMB 1XMBA 2R7VA 1AFJA 2BJDA 1TVRB 1FRXA 3JTOA 4DR5J 3DC2A 4ETZA 1W26A 3MFIA 1U1QA 4OYOA 1LW2B 1MN9A 2MHEA 2HSEB 2V4RA 3RRGA 3M8WA 1EETA 5C42B 1L3TA 3BREA 1HNZF 3GONA 4JI6J 4GKJF 3DLGA 2J6SA 4F4KA 2QLXA 3D67A 3M05A 2LQ8A 4DQRA 1RDRA 4BDPA 2R2RA 2FIUA 4ZK7M 2GGPB 3QSIA 5C2GA 3NNHA 1SVDA 2U1AA 3WIVA 2O66A 3CJRA 4V19J 2E5LF 2N4CA 2CNOB 2QV6A 3V6JA 4KH1B 1S97A 4JI0F 4KGMA 5K8OA 4IDKA 1LWFA 4PEOA 4I2QB 5DO2A 2GW8A 1HNXJ 4L74A 2XB2D 3I82A 2GQQA 2ZKTA 4F67A 4DL6A 1IXKA 4USVA 4OYMA 1O5JA 4YN3B 3DOMB 2KDOA 4EFAC 3TYTA 1YBUA 1NBEB 4MH8A 1K47A 2F5GA 4KY3A 4NEZA 4DX5A 4B9UA 3FSIA 2G1DA 3HZGA 4PZVA 4FYDA 3GCXP 1UWBA 2CIMA 2IDLA 4RUHA 3J7ZT 1YJ9S 3M6UA 1TKZA 2CPIA 3G6VA 1NKEA 4P6QA 4HACB 1V3ZA 2JC0A 3RGIA 5E3RA 3RZAA 2E9ZA 4R0EA 5T41A 3NMRA 4I69A 2WVEA 3MEDB 3FMBA 1VLYA 7FDRA 2POKA 1LEOA 3D0HE 1UP1A 1LW2A 5KT5A 5G4DA 1UVLA 3CCTA 2JLFA 1B70B 3A3OB 3HHLA 1R8HA 1H2TZ 4NLPA 2BXJA 3MCOA 1X9MA 4C8KA 3IWNC 4CNYA 3TUZC 5KFRA 5ETQA 2HQFA 3DLEB 4F25A 3O8WA 1JKHA 2QG9B 5CXTA 1AUSL 1M5KC 2Q43A 1HMVB 3G71S 1HNZJ 3W9JA 3K57A 5KG2A 3M30A 2B56A 1XNRF 5GAHI 5B09A 2V50A 3OLAA 3PKMA 3G82B 3H90A 3KJNB 5IFMA 3KLEB 2CQHA 2LA4A 3I9ZA 1IKYB 1E6VB 2CKWA 2UUWA 2AEMA 3DKDA 1J5OA 2B9YA 3MM9A 4NASA 4DR2J 4DFMA 1XMQJ 4UY8T 1Y0HA 4CCHA 3PO5A 4C8OA 3IRWP 2DGSA 5CZVA 1NJIT 2EK1A 3MZIA 4FPRA 1GXUA 2ASLA 3MWBA 4FNIA 3KMSA 1FWKA 4GVBB 2RF2B 3Q22A 2B8QA 2UXDF 3BSAA 2XWYA 2CPZA 1UWBB 4EBCA 3LANA 3DU6A 3RR8A 1D09B 3A8KA 3DDNA 4OV1A 1SV5A 2PEBA 4H54A 3I0SA 1UEKA 5EWGA 2OHDA 2GS8A 4J7CA 3RB0A 2HIQA 4EUVA 1S6UA 3EXCX 2WRMA 2J0SD 4ED6A 1V5IB 3DLHA 2EKYA 4ZMMA 4X4UA 2K3IA 4K4ZA 3BN4A 4P9SA 3BJYA 4OJ1A 4ZDNA 2OGUA 3TX8A 3CCSS 4QPTA 2CQPA 2AGPA 5HQMA 3AQPA 3R2DJ 1MROB 3F41A 2DGUA 3I5BA 2Z57B 4WZQA 5DQGA 4XPCA 2KYXA 4ECQA 4FXDA 3UQSA 1R8PA 2OFHX 3OR1B 4C3KA 4CYUB 1JKHB 3DMJB 3MPYA 4NA2A 2LQ5A 2RSQA 1RLCL 2HQIA 2ZH4A 4NPOA 4JV2A 2ATCB 2WBRA 2X3DA 3P5BP 1QM9A 1S48A 2JZ5A 3CCZA 1JMTA 3LP0B 3MM7B 4RW8B 2ZWPA 1T05B 2WVFA 1Q86T 1PC4A 5D4NA 2XY6A 4UY85 1RWNB 2HWTA 4J9MA 4B9TA 2I9SA 2IRXA 1WKLA 3TQEA 1NK0A 4I2PA 3CSKA 3G86A 4Q7AA 2EK6A 3AAWB 1P8GA 3NWGA 4GMKA 1B0PA 4AFFA 2DNQA 2ZD1A 5IT4A 2Y9HA 3FEYB 2YNFA 4ZVUB 2VPYB 2VQEF 2UUTA 1KSPA 2PSZA 4JV5F 2AGQA 2D3ZA 3SSQA 1KLNA 4CO5A 3KK1B 1KVKA 2SXLA 3SQGB 4CNZA 2BA9A 3K5OA 4ED4A 2ZE2A 2HAIA 4RW7A 5KFDA 4O3NA 3N0VA 2C3MA 2DO0A 4X66F 2ALZA 2BR0A 5AXNA 3J80Y 3ADAC 5IM0A 2NCKL 2XTJP 4LF5F 1URRA 4NCAA 3R5JB 4WFNQ 3JS9A 4B3RF 1VLOA 4F26A 1T94A 1XC9A 1AXQA 1H74A 2B9WA 3CJKB 2KXNB 3DRPB 4ANDA 1SKRA 2HPUA 2AX1A 3CTRA 1UZDA 3VAHA 4O0NA 5ETTA 2FJWA 2EFQA 3IAS9 1FKPA 3M8PA 3FSYA 4ICLB 3PX0A 2DEIA 4K50A 2F8MA 2RKIB 1R6VA 1UJ4A 5FDLA 2ZH7A 4UOGA 3M6VA 3F73A 3AOAA 2EFVA 4JI8F 1RAIB 1WWHA 5F8HA 1VBXA 4ZCKA 2UVWA 1NAQA 1KNZA 3AOCA 3AJ1A 1C0TB 3C6TB 4KGVB 4AE5A 3PEHA 5LXYA 3OVBA 1RT4A 2W2MP 4NL5A 4Y2KA 3CJ0A 4F3QA 4ZIWA 2C2EA 2FJXA 2FLLA 3SEOA 2YWWA 2MQMA 2YKQA 4A8XA 3MUVP 3G6YA 1R89A 3OXLA 4R5PA 2DGTA 3M8QB 4J9KA 2AU0A 1QUVA 1RHRB 2O3DA 4AXIA 2MY7A 2WSCC 4FNHA 4PYAA 1HQEA 4UF4A 1A7GE 3QAEA 4B3OB 2IPOB 1QDUB 1S59A 1NK8A 2L08A 3ZXWA 1RT3B 4DDFA 1ZS6A 2UXBJ 3BN7A 3EPIA 2E1AA 3HLUA 3SQGA 1ZM9A 2FYXA 3T41A 2VODA 4HH0A 4OZ5A 3TZZA 1H73A 4U67Q 3V4IB 1JLEA 4MKAA 2Y1RI 4N47A 1RP5A 4USMA 2QL9B 4I68A 4ECSA 3DGPB 3HJFA 3TAPA 4ZKAA 2VBXA 4IFYB 5A2QU 1N4LA 4FXWA 4IRCA 1YJRA 3PR4A 2VFSA 1U0HA 4LFCF 1WOOA 1NDKA 1NSPA 5D4OA 1HNVB 3AJ2A 1HI0P 1O51A 3IG1A 3HD1A 1CEZA 3M1VA 4LQ9A 1N5VA 1HFEL 2XYPB 4ECYA 3MM6B 3QWPA 4KR0B 1YZ6A 2WHOA 3LTOA 3AH6A 2IVFB 5DETA 4B3SF 3FMWA 1BQMA 4BBYA 1RT6A 3D4JA 3EZOA 1TAUA 2NXCA 2R7QA 4ILMA 4LSLA 4QIGA 1C1CA 1NJYA 3MEEB 1HIYA 1LWFB 3LGMA 2RUGA 4DPTA 3V6DA 4ZPCA 1FJGF 2Y8WA 1OYDA 2C3YA 1RWUA 3G6ES 2ZDPA 3MMBB 2WB4A 1SUQB 1IBMJ 1RACB 2YVSA 3H5UA 3IWXA 4YP3A 3QBCA 3BPDA 5ETNA 5F41A 4IG0B 3DYAA 5KFAA 3TNVA 3CMQA 8AT1B 1RT3A 4MYUA 4IR9A 1R31A 3IMQJ 3P49B 2GO8A 1M90T 4LT6A 3PIOQ 4ED2A 4URQU 2Y1JA 1U1PA 4JYAF 2HHUA 3GIRA 2R7XA 4DL0C 5I3QA 2GAHC 1NM2A 1FDBA 1X5OA 2FDNA 4HACA 1MMDA 1WC6A 5J2MB 2XCPA 1IJEB 3IFEA 3BQ1A 4LRBA 2KT2A 1SH0A 2CWXA 4DMZA 2DGWA 5ADZA 3CJSA 3UI3A 5KG5A 3KLVA 2DCLA 2OIHA 2VUGA 3DXSX 1B7YB 4O23A 4F4AA 3NL0A 2E7WA 1LWXA 2OMOA 2XMWA 3FSXA 4I2QA 2H1YA 1PILA 3DLEA 3SFUA 1RT2B 2QLFB 2ZOFA 3AD8C 2J0XA 5KFEA 2W9CA 4OLPA 3VGVA 3MM6A 2BJ7A 3A3NB 4DR6F 4ECZA 4HHJA 4ELUA 4K59A 4R8UA 3LP2B 2VB6A 1UETA 3DU5A 2MKJA 4F4YA 2IYIA 1Y4ZB 3WC0A 1RT1B 3W60A 4XIUA 1UFWA 2IFXA 4FKYA 4AL5A 4GC6A 3JYTA 3HP6A 1CC8A 1VQNS 3M32A 4LF7F 3EPGA 5F9NA 4PUOA 1KR4A 1TKDA 2YH1A 3CNQP 5CYMB 3TW0A 1RHKB 4G1IA 2CJYB 2CFXA 1TL5A 5ETVA 1N6QB 4CO3A 4DR7F 1HWLA 1KQSR 4X4NA 2V0NA 3N4WA 1TTHB 4ZHRA 5EX3A 3DLKA 4U6PA 1IKVA 3K5NA 3BGOP 4RNFA 2NZ4A 2V2QA 3OFGA 3TAMA 2EC0A 4MKVA 1RT5A 1D8ZA 4PQUB 5L9XA 3K5PA 2UXBF 5ETOA 5DDOC 4QW8A 4C11A 3VQSA 1PYTA 2A6OA 2BM0A 3TZXA 4JI5F 4ID5A 1WUUA 3C16A 3NRBA 3BGRA 4NI2A 5L38A 4RUAA 2QA4S 3T1YF 2IA6A 4ZVEA 1S1TB 3C3LA 4KPCA 2C2RA 5L46A 2CJXB 4X65J 2GJ2A 1NPRA 4RW9B 1FDDA 3A1YG 4RNNA 1FFGB 3NEKA 3GQCA 4A8SA 3BDPA 1RJJA 3KXDA 2HVIA 2VFUA 2C42A 2JNJA 4H4MB 3RTVA 1Q82T 3DCAA 5HROA 4YB7A 2VPXB 2JWNA 4EI2A 1RHQB 1WOSA 3D54A 4HDGA 3GE9A 3MGJA 1IKWA 4K5SA 4RW8A 4X4OA 2FLOA 1HI1A 5DDQC 2ZH1A 2C2ZB 3K2YA 3ENAA 5DRKA 3TUPA 2X1FA 2XGQA 1UA1A 3KOAA 4CI0B 2IM2A 3R8YA 9ATCB 4PPDA 2YQ1A 1RTDB 3OVSA 5FLXY 2MGZB 5J1NA 3MAAA 2MZQA 1WSRA 1D8YA 2EG2A 4HL9A 1IKXA 2EW9A 4KV8B 4PXCA 1F9HA 2A10A 4RZRA 1JX4A 4JV1A 2LLZA 4U96A 4XAKA 2RD5C 4Y0FA 2UU9F 1IKVB 2DXDA 2PMZD 5KFUA 5ITHA 1EP4A 4L72B 2R8GA 4FZVA 3PKYA 1PJ7A 4ANCA 2BJ3A 3LQVA 2W7OA 2C3UA 4NYPA 3S6EA 2VQEJ 2HWIA 1KEKA 4JI4J 1AZSA 1FE0A 1Q5VA 1FX4A 3R7SB 4PCQA 1S77D 1TR0A 3U27A 1IVZA 1PAEX 2Y0BB 1IR1A 2PD1A 3ITHA 4C11B 4AUKA 1JLFA 3GTYX 1RK8A 5HK4A 3SI8A 1FXLA 3ZNJ1 1T05A 2KVIA 1EZZB 2CPHA 1YVFA 3W62A 4M1KA 5KFHA 2PFFB 3KHGA 2MKSA 4Y2MA 5B0CA 1V5VA 2QGFB 1KVJA 4Q2LA 2MPUA 2ZWOA 2VL1A 1RA7A 4KJIA 2IM1A 4ICLA 2F8HA 3MTJA 2IJFA 2K1RB 4DI6A 4TU7A 2JEFA 2ZC3A 3O2IA 3PRVA 2X51A 4NXNF 4QYRA 4QYZK 5T7LB 3PEJA 3H4DA 5J1EA 4DL2A 3GFYA 4KTQA 1D9AA 4NA1A 2W24A 3Q86A 5DS7A 4E98A 3A8IA 1F3VA 4Q5VA 1P6TA 1SC3B 2V8GA 3BBBA 5CH7B 2H5IB 2G0JA 2IC3B 2K8GA 4U9RA 1K1SA 4UUXA 1XEZA 1M5VC 3KHHA 2YPZA 1RHMB 3M8QA 1PKUA 1M1GA 3NBPA 3M6WA 1RABB 4ETXA 1MG7A 3MPWA 4LRDA 3ILJA 1UL3A 2I6WA 1YI2S 2P2CB 2AYGA 4B3OA 2VBZA 1E6YA 2QX0A 2CRLA 3PTWA 1IJFB 2DNNA 2H65B 2E1PA 6AT1B 5SZTA 4X62F 3Q0AA 3PJXA 2KJWA 4CLTA 4K8RA 4ZVPB 5JVHQ 1PIEA 4XDDA 4JI3F 1VS3A 1FCAA 3HDSA 2N3OA 3SYZA 3CIMA 5CHCB 1F2HA 1XN9A 3SMZA 2EFPA 4AD6A 4K4YA 1REGX 3S1TA 4NLWA 1WG4A 4DS5A 1O6XA 1KKHA 4KT0C 5LT5A 1ZAXA 2ZHAA 2HHXA 1YQHA
chains in the Genus database with same CATH topology
3J7YI 4OHYA 3MM5B 1HWIA 4DL7A 4IR1A 5F8NA 1U25A 4Z2XA 1TKTA 2DNLA 4RBTA 3GILA 3IRXA 3M2VB 1VC6A 2XC9A 1SJ3P 1D9FA 2AQ4A 5HP1B 2XLJA 1KLMA 2W9BA 1ZTWA 4C9DA 2ZVSA 5IQQA 4YB1P 2RIJA 2OPSB 4D3HA 2DTJA 4ECUA 4WFXA 4WFAQ 2M88A 5C5JA 5EUHA 3OTEA 4I6WA 4ES3A 4U7UK 2KT3A 1OQ3A 1WTBA 3CCVS 1S6PB 1XMOF 2HFNA 3MMJA 1JLGA 5K8MA 2E5IA 2FHOB 1S0MA 2OJ3A 2KZMA 1S9GB 1X8DA 2C3PA 3K8WA 5G0RA 1WF2A 4K4WA 3LAMA 3V6HA 1LWEA 3PW4A 1HHSA 4DQSA 1TFWA 3QMQA 4EBEA 5LMUF 3D1HA 1DTQA 2ZOGA 4ZS6A 1VC0A 4DBQA 1TVRA 2OLWA 3CC4S 4MYTA 1DTTB 4FBUA 2JEJA 3LPYA 3O3LA 2IHR1 5KFFA 2OPPA 1P1TA 5KFYA 1S1UB 5GAHU 3S01A 4NA3A 3EX7B 1IBKF 5A8KB 4AL6A 2VA3A 3TVZA 2ZDOA 1IM4A 1RQ0A 3GG1A 3BF4A 3MECB 3CCUS 4TY8B 2BRKA 4BCAA 3W2VA 3VAIA 5AE2A 1BGXT 2KKHA 3PACA 1SJ1A 4WFZA 5KFPA 1FESA 5GAGU 2ZJRQ 3T9ZA 4IKAA 1VQOS 4LSNA 1FK9B 1CQNA 4BHQA 3BGUA 3CJ4A 4DFJA 2CPDA 1FF2A 4Q0BA 3LH2S 4NCGA 1FEEA 4E8UA 1YG0A 2HGMA 3HVTA 3MMAA 5E0OA 2AW0A 3GYNA 3E51A 5C42A 1VQ7S 2DNOA 2YNFB 1FJCA 2JVRA 3Q23A 4MAKA 1K73T 3OL8A 2M5YA 5K8NA 2PI5A 4F4ZA 3E2EA 4RW7B 3ZZRA 1DQ9A 3MMCA 5KFIA 2MSSA 2XZWA 5J2PA 1GQEA 2CQCA 3H20A 2HGLA 4A8WA 2OTLS 3SSSA 1HPZB 1ZM2A 2XS5A 3NS6A 2YKOA 2AJQA 4NLQA 2J8AA 1T7PA 5F3ZA 1KHWA 1S7HA 3MPVA 4NLRA 1YITS 4B3RF 3CD5A 3KLGB 2E5JA 1YIJS 1VQ4S 2LQ9A 3RR7A 2E9RX 2XS7A 2IMWP 2IVMA 2HNYB 2VG6B 1IUJA 2F9JA 2KO1A 5I4MA 2DD8S 3OUYB 3VAFA 4OFZA 2R7WA 2E5HA 2KXFA 1Q8BA 3DOKA 3B82A 4LSNB 3GFXA 1HBMB 2JJ4D 2KZZA 2LVWA 3U1LA 2JOQA 2M70A 2Z4PA 2HHTA 4DWIA 1N48A 2JH3A 4FS1A 1RT7A 1DLOA 2EFGA 1HL6A 3HVTB 4IG0A 1L3SA 1RTHB 2FVRA 4NZ7A 3DDKA 2HS0A 3F44A 5D78A 3MR2A 2IA0A 1T3NA 2D7SA 2VFTA 5I3UB 3UWTA 1D0EA 5HO4A 1O8BA 4QWEA 1VQ8S 4KO0A 3OJSA 2BDPA 4RUCA 5L1IA 4OL8A 2FHJD 3CD7A 2WONA 3UDLA 1HI8A 2N82B 3TR5A 4IG3A 3BZQA 3OJUA 2QEXS 3H2LA 5KFXA 1NRKA 2AF6A 3NG8A 3D5MA 1FRKA 2N7CA 2RMLA 1QLNA 1KQFB 4IFYA 3ZC4A 3KG1A 4YHHF 1NZAA 3FCHA 2PA8D 2Z0GA 3T5LA 1N88A 2HW3A 3BO4A 4RW6B 4MK7A 2BOPA 2I8EA 1SJFA 4X4SA 1WHWA 2BE2A 1QAYA 1K8AT 1WACA 3DOMA 3BR8A 3CCWA 3OTDA 3RB3A 2EFOA 2WB1D 2YKAA 4DG1B 3POTA 1WNEA 1S1WA 4DX8H 4X4PA 4ITSA 1CSJA 1XR7A 5B0GA 2OP5A 3DI6B 2LQJA 4WXWA 2BQ3A 1N6QA 4URGA 4N77A 3RRKA 2ERRA 3CE8A 4NXMF 1E6YB 4RNHA 3V4MA 1N36F 2EPIA 3RBDA 2ZE2B 4A8KA 5I3UA 2BQUA 2CJ9A 1Q79A 1TV6B 1RT5B 1WI8A 4QCLA 1ZBTA 4HDHA 1M5PC 3QO9B 3OSNA 4DSIA 4J5OA 3KK2B 3NMAA 2VKZG 1X4HA 3KG0A 3MM7A 2XY7A 1SJ4P 1CPZA 3DRPA 3PNIA 3NNAA 2DH9A 2QA1A 2X3GA 5F9LA 3LO3A 4IOAQ 1JB0C 1C1CB 5IQ6A 2MZRA 2XHWA 3NLCA 3CMES 1XK8A 2AYMA 3MD1A 2QIFA 3GB0A 3QGHA 3UNGC 3L3CA 3OSPA 1N5YB 1I6JA 4ZP7A 2GQCA 1TFYA 3ZFVA 1U1OA 4RLEA 4LFBF 4PQAA 3FFIB 4WFBQ 2KFYA 2EG1A 3OPKA 4ECWA 1S1WB 3ZZYA 4IUFA 5DGAA 1S10A 5H1SV 4DPOA 4EO6A 3SCIE 1S6QB 4Y34A 2YKNB 2NREA 1FTRA 2DK2A 1X9WA 4B17A 4LFAF 5MAOA 4HT7A 5AXKA 1UJ5A 1U2RA 1C0UB 3N6MA 2M3DA 3ENWA 4OHZA 1GNKA 3HO1A 4EYIB 2HHPA 2VKRA 1TL3B 1FTCA 5CCLA 1N56A 4MKYA 4QR0A 1JLCB 2WTFA 2VC1A 2W4DA 1M5OC 1OQ6A 4FXVA 4QIVA 3LWLA 4Y00A 5KFSA 1N5SA 1MNEA 3LALA 5DDPC 5GAGI 5C24A 4QYZJ 3LF0A 5CA5A 5LJ5Y 1KTVA 2KT5A 2MDAA 3AHPA 4N8OA 4DFKA 4USJC 2W7AA 3IR5B 4KB7A 2EBEA 5F8LA 5GVQA 3M30B 2ZH2A 1F60B 1U24A 1N5YA 4NMLA 5DG8A 2B5JB 1NJZA 1KTQA 2CJQA 2R7UA 3GV7B 2E7XA 2YQ3A 4KC5A 5FJ4A 2WOMB 3CDAA 5LSOA 1S0OA 1HYSA 2ACYA 2IAJA 2ROPA 2VBYA 3I5CA 4MIWA 2AV5A 3DLKB 3PO4A 1R7IA 5F3TA 4B9VA 4TYAA 1DTTA 3THVA 1NH7A 3EGWB 1FJ7A 1AFIA 2XNRA 4CIOA 1C0UA 2R8KA 6FDRA 3LW5C 3J81Y 1IKXB 5D4PA 5THWA 1TKXB 3THPA 4K4TA 4ZCIA 4PPZA 3MECA 4OX6A 5CCMA 2BRLA 3PX6A 1UAWA 5IT9Y 2HHHF 4I56A 3T19A 1YJVA 1FVSA 3DNCA 4OJ3A 3EYZA 1UW4A 2W8LA 1IKWB 1Y3JA 4IH7A 3TP2A 2FJEB 1RT4B 1RT2A 1JNZB 2HNDA 4GC7A 2KXHA 3MI7X 3PW5A 2A2CA 2ROEA 2ZNZA 3EGZA 1WHXA 1Y3KA 3JTNA 5D3GB 4LUBA 1IR0A 5A0YB 5KFJA 3LP2A 5IT0A 1BQNB 3RB4A 2G0CA 2OPRA 4WTYA 3J7A1 3KK3B 4UUWA 1WF1A 2YX4A 3I56S 2YKMB 3M9OB 3M2RB 1ZH5A 1V3SA 1JLGB 1QSYA 1U1MA 3N6NA 3OHAA 1ZETA 4DF8A 3GV8B 1LWEB 4C3MA 3VALA 1VRUA 3GZ7A 2QSWA 1BC6A 1NEEA 4HH1A 5D4LA 3IGVA 1TUVA 5FD1A 5K9FA 4C98A 3RB6A 3I31A 3VR1A 4PWDB 2RRBA 3LGNA 2LEAA 2GHVC 2QMXA 4ECTA 1LW0B 4A4JA 3CB4A 1JXEA 5E3AA 2PO4A 4AQYF 1N34F 3OR2A 3FRZA 3M8RA 2JFDA 3HK2A 3KMQA 4B3MF 1NH8A 1S1XB 5FIIA 1RKJA 3B4MA 1FKAF 1BWEA 1VQSA 3CXCR 2L3MA 2K2PA 1P27B 4TY8A 4I2PB 1IKYA 1G3OA 1LKZA 2K7KA 3H98A 5J2NB 1V3RA 3GIIA 2JLGA 4QJVA 3BGLA 2NSCA 4N8NA 1D1UA 3VF0B 2E1CA 5KFZA 4QWCA 2VA2A 2I38A 1UVIA 2MZTA 4I7FA 1Q8IA 1Q7YT 4A8OA 4LIWA 4ZPWR 1T03A 1YRTA 2KYZA 3CC7S 2ZJPQ 2ZUGA 2A18A 3PZPA 1VK8A 4HTIA 4IOCQ 5J2MA 5CZXA 2OIHA 1VRUB 1N52B 3DRRA 4JI6F 1FD2A 1VQLS 5DM6Q 3KLIA 1GX5A 2BZ2A 2D9OA 2FJBB 4OQJA 1YWXA 5E3QA 3N5FA 1FXDA 2EI5A 3KJVA 3MURP 4DSKA 2DVIA 4H4OB 1NJXA 4LF9F 1HQUB 1C0TA 4NRTA 5T14A 3W3SA 2GMJA 2VFVA 3J7Z5 3N5BA 1U45A 1UMJA 3TQ1A 3KLHB 1KD1T 4MFBB 4PG6A 1N0VC 2KHDA 1HQEB 4PR6A 4Q43A 2ALZA 2DHSA 3GG0A 1D3WA 3CD6S 3CO9A 3T1HF 2M4MA 4TLQA 2AYEA 2VOOA 3AQOA 3HHKA 1YSJA 1LK7A 2YH0A 4EEYA 5K14A 4DLEA 2Q79A 4J9LA 2R8JA 3K58A 4HLBA 3BS9A 5I3PA 2R7OA 1RTHA 4OHXA 5GAEU 1NKBA 1L5UA 4PQUA 2DITA 4I6YA 2V5HG 1V9OA 3HHLB 1VQ5S 3CCLS 3PM9A 4HVZA 3RAMA 3AB2B 5AE1A 2ILYA 5B7WA 2OMLA 2PC6A 3LAKA 4IG3B 4URSA 2M52A 4RW9A 1GT8A 3N28A 1VHFA 1HQUA 2HRYA 5AXMA 3DN9A 3K0JA 2P5VA 3M6XA 1R0AA 5J2QB 5HL7Q 4Y2IA 3IS9B 3MM9B 1OS5A 1IBMF 3KNAA 3OR1A 1NKCA 1S9FA 1DZ5A 4R0JA 2D74B 1M1KT 1HWKA 3LP1A 2DNPA 1T02A 2FD2A 4I6AA 4USHA 2L9NA 3SDEB 1W2IA 4JUZA 5L1JA 2VONA 1HNIB 4QU7A 3T5JA 2IM0A 2Z2LA 3DLBA 3Q8RB 1KHVA 2GX8A 1X0FA 3JSRA 2ZBCA 3HFKA 3PIPQ 4A8MP 5SUHA 1OIAA 4ATNA 1Z2LA 4KFBB 3I6PA 4C2MA 5DG7A 1TKTB 4NX9A 3DGPA 1Y00A 3DRYA 2OD4A 2PIIA 3ZZOA 1N32F 4A8QA 1DQ8A 3EUNA 4WCEQ 1QAJA 4HI1A 2HVZA 3SV3A 3KK2A 1C1BB 2FTRA 5IZHA 3MEGB 5B0AA 4CH0S 2JEGA 1LOUA 3MDFA 2BVZA 4OX7A 1RKIA 2J7UA 2BUNA 3AA8A 1WTFA 1G7CB 4C0OC 3C46A 5EGYA 2B7CB 1HBUB 2IC3A 2LCWA 2DB1A 2GHPA 2YNHB 4TLRA 2DNYA 3DM2A 4XDCA 3U02A 1NKEA 2N4DA 2Q3PA 2ZD1B 3OTCA 3P5TL 1MU2A 1L3VA 4B9MA 4O3SA 4LMZA 3JSMA 5KT7A 4ILRA 4I64A 2EFNA 3DFEA 2V8DA 4PG8A 4JI4F 4X4VA 1SIZA 2ATLA 2LMIA 1VGYA 3UCUP 1ZYQA 3OHBA 3M2UA 4DL3A 2MKHA 1YGYA 4IRDA 5K8PA 5E41A 4CT9A 2FJDB 2OPPB 3T5KA 2GCFA 5KT6A 3QJJA 2CQBA 3JSYA 3MD3A 3T5HA 1KQGB 2EBGA 4FN5A 4KHPF 4MK8A 5HQ8A 2W7PA 4K5RA 4J9PA 1PO6A 2KFNA 1KOOA 2B9XA 2BANB 4CH7A 4QPXA 3VAMA 4ZLPA 3HHLC 4ERDA 1REVB 4YDXA 4TQSA 2CQ4A 2GIQA 2GC8A 2YNGB 1G2EA 3S8SA 3H4BA 2J5AA 1F9FA 2XMKA 3O1LA 3U1MA 1G6BA 2KI2A 2VPZB 3I0RB 3EZUA 1KC8T 3SXLA 2JX2A 3IG1B 3E01B 1GXLA 4NCGB 2PMHA 4YEAA 1XR5A 3RU0A 1WEXA 5K5MA 5T7LA 4ELVA 5KG7A 3BSNA 2IBKA 3M32B 2P6TA 1X5TA 3DXBA 2YNIB 2V8VA 3IAM9 2B4VA 1SJRA 1H7XA 2JLEA 2QYCA 3N6LA 2PI4A 1GH8A 4OHWA 3OL9A 3HKWA 1TV6A 3MMCB 4MJKA 4KHRA 1NK4A 3X1LB 3PRDA 3M9NB 5L8RC 1HR0F 4YUDA 2GMLA 1N54B 1S6QA 1SH2A 4OZ0A 5AE3A 2P9GA 1ZAVA 4NLUA 1S1VB 3DRRB 5GADI 2H5EA 1QSLA 5F0UA 1LXJA 4OI2A 2HMIB 5CYJA 2VG5B 2K1RA 3IXQA 2MY8A 3FQLA 2MQQA 4C8MA 4YR2A 1WEZA 2BV3A 3HVRA 2NR0A 2ZNYA 2HNZA 3DRSB 4RX6A 3GFHA 3NCRA 3D1QA 1HBMA 1F5CA 2P9CA 3NS5A 5HP1A 1U4BA 4MMOA 3M4XA 2XCAA 3SSRA 4ZOSA 4I1TA 1RYSA 1OSCA 3SV4A 2FB0A 2HLTA 5DGBA 1QSSA 2XI2A 2HNYA 3MUMP 2W9AA 2MYFA 2K7JA 1MW7A 3MAQA 3WBZA 2B5JA 2RILA 2WSFC 3CUNA 2CPEA 3EZ5A 2KN4A 1FE4A 3FQKA 2AYBA 3IC1A 4F4XA 2CJAA 3R5AA 1HA1A 4KV8A 2DISA 3QPIA 3UD4P 3ENQA 3PV8A 1YJNS 4YMEA 5KFLA 1CQMA 2QO3A 1GAOA 4PXDA 2B4OA 3Q2TC 2VBWA 2CYYA 3OW2R 2DR8A 3LWMA 3K5LA 1X4EA 5KT2A 2FLPA 5F8JA 4C8LA 1NNDA 3DLGB 5IS2A 2R7TA 1DTQB 1RTIA 1GX6A 3DLJA 1B0VA 3OFEA 3OXGA 4QW9A 4F4WA 2RVJA 2CZVC 1PGZA 4OJGA 4WYLA 3U1NA 1UEUA 3KFWX 1QAXA 2DBBA 2E29A 5E33A 4R8UB 4FF4A 1JWWA 2A3JA 3POTB 3UDCA 4DL5A 3FEZA 2JEIA 3BDEA 2NSBA 2WW8A 3TO8A 1VFJA 1W2BR