6FDRA

7-fe ferredoxin from azotobacter vinelandii at 100k, na dithionite reduced at ph 8.5, resolution 1.4 a
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
106
structure length
106
Chain Sequence
AFVVTDNCIKCKYTDCVEVCPVDCFYEGPNFLVIHPDECIDCALCEPECPAQAIFSEDEVPEDMQEFIQLNAELAEVWPNITEKKDPLPDAEDWDGVKGKLQHLER
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Oxidized and reduced Azotobacter vinelandii ferredoxin I at 1.4 A resolution: conformational change of surface residues without significant change in the [3Fe-4S]+/0 cluster.
pubmed doi rcsb
molecule keywords PROTEIN (7-FE FERREDOXIN I)
molecule tags Electron transport
total genus 30
structure length 106
sequence length 106
ec nomenclature
pdb deposition date 1998-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
A PF11953 DUF3470 Domain of unknown function (DUF3470)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 6fdrA00
1B0PA 2C3MA 4XDCA 1GTEA 1FTCA 1FEHA 1B0TA 1GAOA 1H7WA 1C4AA 2FGOA 1FD2A 1FRIA 1JNZB 2WB1D 3MMAB 4CI0B 1BQXA 3MMAA 1KQFB 2VKRA 1ROFA 3MM6B 5BYSA 3MM6A 2C3OA 1Y5LB 1FF2A 4RKUC 1DURA 2XSJB 2C3YA 1F2GA 1GT8A 1HFEL 3OR1B 1D3WA 6FDRA 1VJWA 3EGWB 2FJBB 1FDDA 2PA8D 1Y4ZB 1FCAA 3IR6B 1SJ1A 3LW5C 1FRMA 1BC6A 4KT0C 1XERA 3MM8B 3MM8A 1SIWB 2PMZD 2C42A 1PC4A 4ID8A 1FERA 1FXDA 2C3PA 2ZVSA 2O01C 1F5CA 1FRKA 3C8YA 1B0VA 3IR7B 1Y5NB 4L6V3 6FD1A 1DFDA 2WSFC 3HKZD 1H7XA 2VPYB 2WSCC 1JNRB 3GYXB 1FRJA 1Y5IB 1FDAA 1Q16B 1BD6A 1KQGB 2FJDB 1RGVA 2WAQD 3EXYA 2FJEB 1IQZA 1GTHA 7FDRA 2VPXB 4XDDA 5BYQA 2FDNA 3PNIA 3MM5B 2C3UA 3MM5A 1FRXA 2UZAA 5E7OB 2VPWB 4OV1A 4DHVA 3EUNA 4OMFG 2IVFB 1CLFA 3MM7B 3MM7A 1SIZA 2FD2A 1AXQA 1G6BA 1BWEA 3MMCB 1FRHA 2Z8QA 3MMCA 1H0HB 2PDAA 3IR5B 1JB0C 2GMHA 5L8RC 1G3OA 5CHCB 4YDDB 1C4CA 1FDBA 1KEKA 5FD1A 2VPZB 2WSEC 7FD1A 1IR0A 3MMBB 1FXRA 3MMBA 3OR2B 5CH7B 2V2KA 3OR2A 5BYRA 2GMJA 2V4JB 2XSJA 1PC5A 2V4JA 1A6LA 1FDNA 3MM9B 3MM9A 2FJAB 3OR1A 4Y28C 1K0TA 1R27B 1H98A 1FRLA 2Y0SD 1BLUA 4AYBD 1F5BA 1DAXA 4XK8C 1WTFA
chains in the Genus database with same CATH superfamily
1ZPVA 2APOA 1N54B 2RU3A 4RUCA 2GVZA 4OI4A 3M2UB 4OYWA 2OAUA 2MQ8A 4RJVA 2MQLA 2HRYA 3HDSA 3M8RA 2UUBF 2DGWA 3KLEB 2W8LA 5GAGI 2JEJA 1XERA 1VISA 4YOEA 1O6XA 2FY1A 5HO4A 4LF5F 1YJWS 1R0BG 4TYBA 2HKEA 5DLGA 2HHSA 1S12A 4ICLB 4G6VB 1QSSA 4CT9A 4Q8EA 1YRUA 5HROB 4EBDA 2FUG9 2OP5A 4N56A 3NGUA 4DN0A 4OYIA 3PJWA 5DDOC 1HMVA 3SDEB 4DV0F 2V94A 1GNKA 1RT1B 3IM9A 1NO8A 3JTPA 5HN0A 4M5LA 2YBVA 1YG0A 1B7FA 4ID5B 2QMUB 3I32A 1DZ5A 2ZKTA 4NLXA 3KDOA 4NEYA 4P2MA 4DPOA 2QMWA 1AZSB 1HA1A 1RYSA 3MDFA 4WTYA 3TOQA 3I0SA 4QYZK 1YITS 2EFOA 4B9NA 1FJGJ 4ZA1A 2ZH6A 5JVHQ 1VBYA 2BJ7A 1HPZA 2HVDA 1CULB 3KLHB 2QRRA 1N5TA 1B99A 4M5DA 2BANA 4FF3A 5GMKa 2L9WA 4GMKA 1TVRA 4IH7A 4C0HA 5FLXY 3JQKA 4Q2MA 3CTRA 4MKYA 1JMTA 4FPRA 2XYHB 4DHVA 4C48A 2R7TA 1UA0A 2HFOA 5LMUF 2HSEB 4M8LA 5HQLA 4OZLA 4RBVA 3ICLA 1RP5A 5CZVA 1TKTB 1D9AA 5CQGA 4H4MB 5C42B 2W2PP 4F4XA 2YKNB 4TYAA 4UOCA 3LQVA 2YNGA 4LF4F 1U2CA 5GVQA 2E7XA 3KJQB 4EGLA 2KRBA 3ISZA 3SV4A 5A8RA 3I4PA 2LYVA 4K8RA 2J6SA 3FEXB 3ISND 4J9RA 2HIYA 1N56A 2PIIA 2KN4A 3L4BC 3IS9A 2YH0A 2LVWA 3H0PA 3C19A 5DG9A 2F4FA 2F4VJ 5DZ7A 2KHCA 2WZ1A 4Y34A 4Z7CA 3NGSA 3PW2A 2ILYA 4J37A 4WYWA 3GYGA 2IMOA 2CQ2A 2QGFB 2HS0A 1S6PA 3H4BA 2XS2A 3G6XA 1RAFB 5L38A 3C2PA 1RGVA 5K8PA 2QV6A 1K1SA 3HFZB 3G8QA 3DU5A 4R8UA 3IMQJ 4DR6F 1I3OB 2AJQA 1KR4A 2F9JA 4W92B 2XWYA 4GKKJ 2ZH1A 1VRUA 1YJ7A 3C3LA 4F4ZA 3R5GA 3SMZA 4B3SJ 2XZTB 3MPVA 4K0KF 1IR0A 3HHNB 5IFMA 3FSXA 1Q7LB 4IFYB 3N6NA 4YDXA 1L5UA 4DV4J 3H40A 1L3KA 4R25A 5LSRA 1PG5B 1DLOA 3DM2B 3A13A 4QZVB 3W63A 1Y5LB 1FF2A 2YWGA 1M5KC 2DHAA 4NRUA 2KT2A 2VG7B 3US5A 1R7IA 3P4UB 3CCLS 1RBLA 2CQBA 4OZNA 1F3VA 3PX4A 4WBFA 3M1VB 4X62F 2KJWA 2UUAF 1WNEA 1MROB 5SUHA 2JOQA 3M32B 3H5YA 4KHRA 2FHOB 4UW2A 1AROP 4OX6A 1TZ0A 3BO4A 2VPWB 4OV1A 4K50A 1QY7A 1K8AT 4HHJA 4Y00A 3PIPQ 3BJYA 5C7PA 1IKWA 4OFZA 4RZRA 5CH7B 1RAIB 1RTHA 1SKWA 2I6WA 1U1NA 3DRPB 5JUMA 2X3GA 4LF6J 4DL7A 2DRAA 3CB4A 3A8KA 4IOCQ 4PQUB 4TKTA 1DHMA 3NBPA 4U6PA 2GJIA 1HNIB 1AUDA 2QLJB 2OPRB 4ED1A 2EFQA 2U1AA 4LSZB 1IUJA 2XY6A 1SQGA 1JQGA 4DMZA 3IR7B 2Q66A 1U1OA 2J0WA 2IAJB 3BV8A 3C6TA 4Z7YA 1T0TV 2AEJA 1ZM4A 1QSLA 4FBUA 4FYXB 2OGUA 4A48A 4ZCIA 3T3FA 4G65A 3ZTSA 3PTWA 2OO4A 3IXQA 4I2QA 5ETSA 4F02A 4YHHF 4IH5A 2AGQA 3K89A 3R5DA 5B08A 4M5HA 4EFAC 3BO3A 4FYYB 1LFPA 2CWXA 2F65A 2WK4A 1KTVA 3Q0AA 2BW7A 1FX4A 4RL1A 4N8NA 2NSCA 4OI3A 1DAXA 2EFPA 3G82A 3KG4A 1V5VA 2ZBIA 3HK2A 1EETA 2RVJA 3A12A 3VF0B 5G0RA 1S57A 1S1VB 3CMES 3QLHB 2J9DA 3BR9A 1DTTA 3FMWA 3AOCA 3GE9A 4ZCMA 5E3PA 2D74B 1RT4B 3I0RA 2MYFA 3PO5A 3KMQA 4WJBA 2MZTA 4PUOA 3EVOA 2ZOMA 2C3PA 1RHUB 2FVRA 1B0VA 1N0VC 1UZDA 1KQSR 4LMZA 1KQGB 2R7VA 3CJSA 5D3GB 2FLLA 4QWCA 2QL9B 2ADBA 5I3PA 3QMQA 5HMZA 3P8BB 1PKUA 1EHWA 3RBDA 1NB7A 4YB7A 1T05A 2DCUB 2VZ9A 1NPRA 4EBCA 5KAKA 4DF4A 3HD2A 4A46A 3T41A 3GU0A 1A9NB 1GAOA 1TELA 2GNKA 1UETA 1HARA 2R8JA 3CC2S 2X51A 3PJXA 3Q83A 4ANEA 4LSLB 4XAKA 1KQFB 2F4VF 1QAIA 1F2HA 1I6JA 2WVBA 2ZITA 2P6SA 2Q6CA 1B3TA 2XY5A 3WIUA 4WZMA 4OX7A 4CM2A 4LQ3A 3TX0A 3LAMA 2YWWA 1VK8A 2XO7A 1LWCA 2HVZA 2AZ1A 3NGDA 4QR2A 3MEEB 1HQEB 2W2OP 2C2OB 3DLHA 4P7VA 3TP2A 2ZH3A 3AB4B 4FNHA 1JNRB 1FFWB 1RXOB 1VBXA 1CC7A 3LP0B 3KJVA 2DHGA 4OZ5A 5BYQA 3KLGA 1UL3A 2R2SA 4U96A 3JSYA 4FP9A 2DHXA 3CJRA 4O3SA 1GXUA 1YBUA 2MHNA 3S7RA 3G6ES 1XK8A 1UKUA 2AJ4A 3BKTA 3POTA 5HVHA 2CYYA 3V4MA 1NUEA 2MTLA 4UOFA 4PYAA 3DKDA 3HLUA 2LA4A 2MKKA 2V4JA 4DV4F 4UOHA 1T11A 1TU0B 2RSQA 4PABA 5KFUA 5A8WA 1UAWA 1UVJA 3FQKA 1IR1A 4B3MJ 2HNYB 3JSBA 4G1QA 1CJTA 4IG3A 2ZJRQ 3R6GB 4BCAA 3IBFB 4KT0C 4LVOP 1J5EJ 2JJ4D 2RRNA 1HL6A 3GIRA 1UA1A 2PMZD 4TY9A 2CJXB 3K8WA 2HQDA 2N82B 2A10A 3HKZD 3QRRA 1F5AA 5F8MA 2WSCC 1BQNA 3EE3A 2B9YA 3VGVA 4C3LA 1TP7A 3OTDA 4TY8A 3PIOQ 4JI7J 4ECUA 1S97A 4ILLA 3QWUA 2LXIA 3PFOA 2C2RA 3BGOP 1FKOA 4CIOA 4Q2LA 3ETOA 4OZ2A 4FYWB 5HATA 3TEGA 2U2FA 3GR1A 4OZ0A 4RBUA 2FLPA 1IKXB 1X5PA 2B7CB 3VV2B 2QL5B 3M8PB 3SFUA 4WYLA 2JEGA 4I2PB 5HAOA 1LK7A 2OD4A 2FIUA 5DGAA 4LF6F 4L76A 4PG6A 1X4AA 4K4VA 4UTGA 3C15A 1IWGA 2W9BB 3DOLA 1KLMA 2BUNA 1QAXA 4G3IA 4UUWA 2HQCA 2MLXA 4PYDA 1Y7PA 1E6YB 1Y11A 1HYSA 1GMWA 4UZCA 4OYMA 1LNQA 1WC0A 2CDRB 1JLQA 2ASJA 4DOZA 3TARA 2YWEA 5HBMA 5IOLA 2VPXB 3IRWP 2BV3A 4L3KA 4JB8B 2L41A 4HTJA 3CIMA 2L9NA 4CLZA 1YBAA 4MH8A 4DCPB 1FESA 1TV6B 4WIIA 3FJ2A 2HVEA 4NLSA 4YR2A 1X4DA 2V5HG 2PD1A 2JSXA 3V4IB 2M2BA 1DRZA 4QPTA 2GO9A 4WK3A 4F25A 3OR2B 3H2LA 2XYPB 3QATA 1PC5A 5IXUA 2GCFA 3DLGA 1XMQJ 1CJKA 1Q8IA 4DQSA 3GFYA 1YDLA 2OPQB 2WRMA 3M2UA 3PEHA 5KFPA 5C25A 2RMLA 4LF8J 3HSJA 1CPZA 1SXLA 2DJWA 2HNZB 2AD9A 5HVFA 4ER8A 3QGGA 4GC6A 3CCUS 2CPJA 3D0IE 3DGVA 4NLUA 1SUQA 2DR7A 2R3VA 4DR1J 3HVRA 3C6UB 1XR6A 4KE5A 4FNIA 2WSFC 3JSMA 3M8WA 4FF2A 3J80Y 5AJ3F 3EDQB 4DV6J 5B0DA 4ICLA 3RAXA 5I4MA 2FJEB 3Q8UA 2QO3A 5HROA 3PCOB 4UY8T 3I4HX 3W60A 2CG4A 2FB0A 2XHWA 3M2VB 2MQPA 4RNHA 2HK2A 4DUYJ 4MKBA 2FLNA 2ZD1B 2RS8A 1RT1A 4NZ7A 2VFUA 2I9SA 1TUWA 3I96A 3QT7A 4OYPA 3RRGA 2L9DA 2IM0A 4FYVB 2EKNA 4ID5A 3R2DJ 1AZSA 1FEEA 2DH8A 4LFCJ 4ECWA 4XTTA 5LSOA 2A6OA 5H9EJ 3J80U 5CAAA 4F36A 3NNCA 2LA6A 2MKIA 1NPKA 3F44A 2O1PA 4CQ1A 1T03B 3LW5C 3U1MA 2E1MC 3KLHA 2V68A 3RAMA 4ES2A 3E01B 4RW6B 4MFBA 2GAHC 2ZUGA 2DGUA 3UDCA 2R2UA 4MTPA 2GMLA 1PSDA 1OPZA 5KFDA 1HBUA 1NH8A 1MNEA 1ZBTA 4PAAA 4I0WA 2HRUA 3T1YJ 5A76A 4CWBA 2JC0A 5U47A 2FZKB 3PDNA 1UJ6A 4NCGB 1ULRA 2CIMA 1TKTA 4H4MA 2EPIA 3HM9A 2YKNA 4ECYA 5LL6d 4ELUA 2PMWA 1NHVA 2HMIA 1JLBA 2DNHA 4LREA 1U4BA 3D28A 1RAHB 2IPOB 3OLAA 5HP1B 4GKJJ 1REGX 1U25A 4F0KA 1URRA 4I56A 3CJ0A 1MW7A 1J5EF 1VJWA 2FQQB 1TMJA 1OO0B 4JI0J 3TRGA 3V6HA 3KK2B 3R1LA 1Y5NB 2NR0A 1T7PA 3N6MA 5D77A 2J7WA 2VFVA 2QFJA 4LUBA 4EEYA 2BYCA 2F7VA 2DVIA 1MSWD 4C7QA 4JI7F 2HGMA 1CBKA 1MMDA 3CCQS 3PY8A 1RWVB 2DGTA 1I94F 2MZQA 1ZYQA 1KONA 1K44A 2EC2A 3MR2A 4MYUA 1WOOA 2Z8QA 2DITA 1QAYA 1X4FA 4M5NA 2EI5A 2DK2A 1UFWA 3S01A 5K8OA 3CSKA 3K17A 4NL5A 1RKJA 1GH8A 5DDPC 3SSSA 2FJAB 3D5MA 2DNZA 3HSDA 2JVRA 1Q82T 3R7SB 4LIWA 5IM0A 3BSNA 2JLGA 3AA8A 3RRHA 1H74A 3CD7A 2E66A 4IO9Q 2GS8A 1SC3B 1WORA 1M0SA 2A1BA 2EC0A 3OXFA 3CCZA 3ILLA 2G13A 2O01C 3QPIA 3MD1A 3M1VA 3NOCA 1N5QA 5KFAA 2RDIA 3M32A 5KFYA 2FHKA 2UXBF 2KTQA 4PWDB 2PFDA 3MM5B 3G87A 3NG8A 4D3HA 4XO0A 4JV0A 1PGZA 2LQJA 2W2NP 3FCVA 4CT8A 1HBOB 1VHIA 3G86A 1VCTA 4Y0FA 1Q4RA 3PYFA 4U8YA 3FCHA 2KYZA 2V2ZA 3N79A 2E1AA 1YJTA 5BXIA 5I42B 3MM9B 4I6WA 1AB8A 1R27B 5D78A 1HHSA 2CJQA 3DRPA 4ZPAA 2HQFA 3T1HJ 1RTIA 2PC6A 1ZAWA 5F8NA 3V6DA 1U6FA 4LF8F 2CFXA 3BGFA 2E5GA 4I7FA 4N47A 3QFHA 1HNIA 3D1HA 1O51A 2OPRA 4ID8A 1WDDA 2V50A 3PKMA 3HMJG 4DV6F 2JLFA 2FGCA 1X5OA 3MURP 2IAJA 2COLA 3HJFA 2Y1RI 3FGVA 4DS4A 2C2ZB 3HHKA 3JQMA 1D0EA 2V4QA 4WTOB 4PG5A 4DUYF 2KFZA 3WQPA 5C2GA 3PVXA 4NLTA 4J9KA 4J91A 4Q44A 3B6BA 2C28A 2FLOA 4B3TJ 4P2XA 2XMUA 3CJQA 1TL4A 1SJ3P 2W24A 4UZBA 4F4KA 4RUHA 5DDRC 4KSEB 4UOGA 2LLZA 1CJUB 3GFZA 4LFCF 4IRDA 5A6WA 1RLCL 1B4SA 4YB1P 1S1UA 2M5YA 1S1VA 1XQIA 2XI3A 3QLHA 2QLXA 4TN2A 3TZWA 1F2GA 2XG8A 5GMEA 2XM3A 4X4UA 4IKAA 1RT4A 3FSYA 2HFZA 5LSLA 3MEDB 2EK1A 1X4GA 3R6LB 1T3NA 2M9KA 3M30A 4PZVA 2LCWA 2RH3A 5KFRA 2YWFA 1LQ9A 3S8SA 3VALA 1M1KT 1S77D 3SCIE 1NHKL 2ROGA 4DR5J 3T1YF 3ENQA 4KAIA 5D3GA 1OIAA 4B17A 3W64A 3Q8RB 1VC6A 1HR0F 1CLFA 5D0EA 3MECB 3K5NA 2CQHA 3HHLB 2IC3B 2GC8A 3O44A 5IT4A 2OFGX 1UP1A 4M1KA 1FWKA 3OJSA 3M8YA 2BQRA 5MAOA 3ZFVA 4GKJF 1H72C 3W8PA 4P52A 2WBMA 2UUTA 1DBDA 4W98A 2B8PA 2C3MA 2FPHX 4NZ0A 4LSLA 3QT5A 1NU4A 3H8YA 1YBTA 4X4SA 1WKKA 3BR8A 1HFEL 4JI0F 4YS2A 2KB2A 2CA9A 2FTRA 4PXBA 2VJVA 1KVIA 3BGRB 1SKUB 4B9SA 4HHUA 4CLPA 2VA3A 2HFSA 4YFUA 1HQEA 1YRXA 4JI8J 1KOHA 3FDSA 4L74A 1HNWF 2C1EB 4KGVB 4NLPA 2XS5A 1TAUA 2CVIA 4ZVHA 4QIFA 2V8HA 2JC1A 4DSLA 4KV8B 4LT6A 3D3BJ 5HLFB 5LJ3Y 4QWDA 2GMHA 2BJ1A 3RB4A 4ES1A 3OXLA 4QW8A 2LQ9A 2B51A 4WKRA 4PPDA 2BKOA 1SH0A 1WACA 4DU8A 3IWLA 3VAMA 3DHXA 1NJZA 2E1RA 3W9IA 2VHGA 2ZZNA 2VKRA 1X9WA 1PYOB 4B02A 3OFEA 4ZPWR 5D4LA 4OZ3A 1APSA 4U7UK 3CCTA 1EQ0A 5CCMA 4O23A 2FVCA 1Y4ZB 4DSKA 3WZ0A 3MM8B 3DLKB 1PAUB 3ILIA 1RWKB 5J1NA 3UCUP 4GVBB 4J7CA 3TEHB 6FD1A 3BPDA 2ZBPA 3HFKA 2D9PA 4B3RF 4PR6A 3A4TA 2KT5A 3ILJA 5AXLA 1JJ4A 2BACA 1S0OA 4X4PA 5F8HA 1IBCB 3GJRB 1ZM2A 1DARA 4OMFG 2PE8A 4ETZA 1KVKA 2PEBA 5AE2A 2KFYA 1NB2A 2Z2MA 4F2SA 4DS5A 3EM1A 1EP4B 1N5VA 1RTJB 1IKXA 4LFAJ 1RK8A 2QIFA 4I2PA 3H20A 4C98A 4JI3J 1ZAXA 3CDAA 2EWHA 2G1DA 1FJEB 3VR1A 5BYSA 4KFBB 2HHUA 2W9BA 2ILZA 5L1JA 5KOXA 4CO4A 2A3JA 3BKFA 1YLXA 3H5SA 1E6YA 4W4MA 5D15A 4OZJA 3KLIA 2MZRA 1R6VA 3R3TA 4J9SA 1VIXA 1SC4B 3RW6A 3U1LA 2VPYB 1C0TB 3LO3A 4LRFA 4Y6IA 4DL3A 3DLLQ 1NHUA 5CYQA 1J5OB 3TVZA 4QYRA 5IQ6A 1H0HB 4CH1A 1GX5A 4XPCA 1PJ5A 3V4IA 3NLCA 1F3FA 2DEIA 3IAM9 3K57A 3OR2A 4PG8A 2K1RB 1X5SA 2VC0A 4ALZA 2J9EA 3CD5A 1KWMA 1S9FA 3UO0A 3V6KA 3FUYA 2OPQA 1LKZA 1WI8A 4CM0A 2C3OA 3LPEA 1UCNA 1YZ7A 2BOPA 3VZHA 4I4BA 4LBPA 2HNZA 3UCZP 2NZCA 1R43A 3FC9A 1TL3B 2NPIA 2XMKA 3UDVA 2IA0A 3C6UA 1VLYA 2YQ3A 4DR5F 1IBLJ 4RPFA 2FJDB 3W9HA 1FJ7A 4KQZA 2C3UA 2CXEA 1RU1A 1S9EB 4IQXA 4CLFA 4B9MA 3M2VA 1D9DA 3MUTP 3DCAA 1IJEB 1G7CB 4WP3A 2ZD1A 3BN7A 1R8CA 4LF1A 4TXSA 3U7JA 5EN1A 4F04B 4ZLPA 4DV1F 4YY3J 2HWTA 3KK3B 3X1LB 4AYBD 3PRVA 3G71S 5K20B 2L3MA 1BQXA 4PWUA 4M5JA 2A18A 2XBPA 4HTIA 3HZGA 3PO4A 5E33A 2FVSA 4S0MA 1YRTA 1NK8A 1T03A 4OI2A 3CCRS 3MR5A 3DMJA 2HVHA 2BE7D 3E01A 4JI8F 4RW6A 2C2MB 2P6TA 3QIPB 2ZNYA 3SV3A 4KO0B 5ETTA 1DTQB 3SYZA 4JBCA 2B4VA 2EVZA 2UV8G 5EX0A 2Y1LB 5CXTA 2RU9A 3I31A 3A3NB 3GIJA 3M2RB 4BC9A 4NCGA 1NAQA 9ATCB 2HNDB 3PW4A 4CYUB 2Q43A 2Y8WA 3SQGB 4EI2A 1U7LA 1FRLA 3T6JA 3BSCA 2AU0A 4JYAJ 5HP1A 1RAOA 1VQ5S 3ELHA 2VIHA 2KZMA 1K73T 3QJPA 4UY85 2EFGA 4AQYJ 1SBRA 4KIAA 2HQ3A 2MLYA 3MOZA 4DL0C 5HVGA 3LP2B 2OTJS 1YWXA 3PW7A 4O3PA 2FC8A 3OUYB 4J9UE 3MZIA 1G1XA 3D6HB 5KFZA 1S1XA 1LXNA 4K4WA 1TL7B 4QIEA 1MG7A 3SXLA 4TNOA 5IV3A 4C8LA 2EKYA 3EUNA 2DHHA 2D41A 2DNKA 4OI6A 1FRHA 2CPXA 5IS2A 4K4YA 3GMGA 2YQ1A 2IJFA 2KG0A 2K7JA 1IWAA 5ITHA 1Q8KA 4JI3F 3T5LA 2RKIA 2JH3A 2YXLA 2WVFA 2HGLA 3T9ZA 1S10A 2V2VA 4HEA9 3CXCR 2V0NA 4D3GA 4DV5J 4F4YA 2ZBRA 1FTCA 4Z37A 3JSRA 1TK0A 4YR0A 4CNYA 2IVYA 2XTJP 2BMBA 3N9UC 2MSTA 1OQ6A 4V19J 1M90T 2Y1IA 2Z30B 3PFEA 4DSJA 4IUFA 4ZJOA 3QO9A 1N6QA 4NI2B 4QIVA 2ZC3A 1ZETA 4WE1A 5J2PB 3ZNJ1 4ZVFA 2A6MA 4WK1A 5C24B 2ZOGA 2WONB 4X4VA 2VD3A 4H54A 2AWZA 2FHJA 3J81Y 1FX2A 4PWDA 2EBGA 4ZVQB 4ZJQA 3MM5A 2Q6BA 3P6YC 3HKWA 3MOJB 1V9OA 3C16A 2EG1A 3HHDA 2ZC4A 2MLZA 1HBOA 3OSPA 4O3OA 5ETKA 4O0NA 1NSKL 2G0CA 5AE1A 1YJVA 1AW0A 5D0HA 2DRBA 2GGPB 3MM9A 4WFBQ 3MEGB 2AMCB 1P8GA 4RU9A 5KT7A 2ACYA 3GB0A 4R0JA 4B3OB 3VAJA 2CJBA 4ZVUB 1C4AA 3OTEA 1RT2B 1WHWA 2RQ4A 2ZKUA 1XR5A 4ED2A 5B0EA 2NUHA 1ZZNA 2W7PA 3MEKA 3CJ4A 4ZVTB 4LF9J 4DV2J 3ZZYA 2WCXA 4K59A 1LEOA 4QOTA 1XEZA 2AJ2A 3HULA 3K5OA 1D1UA 3E51A 3PX6A 2DR5A 4DPYA 3TX8A 3JYTB 2CZVC 1K1QA 3CJ2A 2Q1LA 2VODA 1NK0A 3D67A 3Q8YA 4DUZF 1XN9A 3CWJA 4QWEA 2OELA 2CVEA 4Y2IA 1HD0A 3UPFA 1FE0A 3J81j 2HPUA 3KLFB 2GHWA 3AOBA 3CDBA 1RACB 1TK8A 4HL9A 3R5BA 2NCKL 4X4QA 1X4HA 2R8KA 4YY3F 3TI0A 4DLGA 3WIVA 1LW2B 2KU7A 2AKWB 3IN5A 4DR2F 4CO5A 5KG4A 4R5PA 5KFSA 1S1TB 1CJUA 4AT1B 2XEXA 2GIRA 3GR0A 3RB0A 1PIEA 3AODA 1VC5A 3UN2A 2ZHAA 1ACMB 2GA7A 3I5BA 1PCAA 1SV5B 3DU6A 1UWAA 3CF5Q 4J9PA 4HH1A 1S72S 4CLKA 4PG4A 4A4JA 4OL8A 2J7UA 4LSNA 4QW9A 2CNNB 3OL9A 1S4EA 5G4DA 1U47A 1FNXH 3MGJA 2RB7A 2DY1A 1RT7B 1RE1B 1VQSA 2CPZA 3AD9C 1KSPA 2YNFB 2BQ3A 5KT4A 3TQ1A 1TFWA 3MM7B 2VF3A 4ZMMA 3MECA 4WFYA 1S0MA 3HHLA 2CQ4A 3KG0A 3DXBA 2KXHA 4MIAA 2ZH7A 4JYAF 1A6LA 1E6VB 1JKHB 2KI2A 4QWAA 1S0NA 3R8YA 2C2KB 2I8EA 5DLFA 2D7SA 4NLWA 4KKOB 2WB4A 4JP8A 2UXDJ 2E9ZA 2CJYB 3LP1B 2HAFA 2Z2LA 4AQYF 3ZXWA 1IBMJ 1DQ9A 1U8SA 2V8DA 3M05A 4DCOB 4LRDA 4Q0BB 3PACA 3OTOF 4IRKA 3SCKE 5K5MA 3G8TA 2L48A 3BGRA 3ET6B 3PYEA 4KGXB 1ZTTA 2M8DB 1VR6A 4ANDA 1EKRA 3RBEA 5CD4A 4PCQA 2R7XA 3GV5B 2MQNA 2KZZA 1OY6A 3TA2A 1VQKS 5AE3A 2K2PA 4DZ6A 3OT9A 4ELVA 1BQMB 4KV8A 1NJWA 4X4RA 2HWIA 5HLFA 2B7BB 1VHFA 1LWEB 3DGPB 5KFCA 4M5MA 2DKOB 1RHRB 4P6QA 5T14A 4DV5F 4B9TA 3HVTB 1UW9A 1EAYC 2PSZA 2K3KA 1QUPA 2YNIB 2JEIA 2ZBCA 4WIQA 1DURA 3EZUA 4MK8A 1CSJA 4WP9A 1FE4A 4USKA 3SEOA 2MEWA 4EBEA 1MU2A 1SJ1A 2NXCA 3P49B 2CQ3A 3MM8A 3FBEA 3DLKA 4F26A 2J76E 3DRRB 1RWMB 2AW0A 3MAQA 5LOQA 1WWHA 3T9NA 2W2MP 1C2PA 3FBCA 1RBAA 3Q89A 3T5JA 4ZS6A 3DDNA 1RHMB 3WDOA 3QZ7A 2RF2B 3B78A 2BJ9A 1VYAA 3Q8SB 5LXRA 2R7QA 5F41A 3EYZA 2H51B 5E7OB 2QC3A 4EUVA 5E0OA 4DPXA 1M5SA 4NX9A 2Y9HA 3FEZA 2R8HA 4OI0A 3GQCA 1C4CA 1RAEB 1EP4A 1GXTA 3L95X 1XWLA 1RTJA 1YKWA 1TL1A 1NK6A 4FVMA 4J9MA 4FXVA 5K14B 4IR1A 2POKA 4ZCLA 2OEMA 1B0TA 1H3DA 2ZM6F 3BYRA 1FRIA 4KFBA 4RWXA 4FKXA 5E3QA 2HBQB 2H54B 3FKBA 3VAHA 3AQPA 1NK4A 1S0VA 3N0VA 3IGNA 2PMHA 2YPZA 4LF9F 4DV2F 4DLEA 3CDEA 2G2ZA 4ERDA 3ZTPA 3GSDA 2W9CA 2MZJA 2E1CA 1C0UB 2YKQA 4ED7A 3QT8A 4KGKA 2XSFA 4ZPCA 2DY9A 3MD3A 1MMLA 3TZXA 1C0TA 3GYXB 1CC8A 1J2VA 3EPGA 4OYZA 4N7TA 2GQCA 3DC2A 3HHLC 4L3NA 3KHRA 3M8QA 1LK5A 3EX7B 1RWWB 4DSFA 5DETA 2D3O1 4U7UD 3KUGA 2B9XA 4NYZA 2NLWA 3V81A 4CP5A 1HQUB 2XSJA 4RW9A 2R7RA 4QIGA 4O0IA 4JI6J 1U09A 2NYHA 1TKZB 4WFXA 4OJ1A 1FEHA 3SIPB 2AJFE 1S49A 1JNZB 3OTCA 4IO1A 4IG0B 3FQLA 3LWMA 2UXCJ 2BZ2A 3M6UA 5DQIA 3UFCX 3THVA 1LWFB 5A0YB 1M1GA 2BR0A 4XPEA 2B4UA 2VKZG 4WU3A 3EPIA 2B3TB 4CLTA 2OPSB 4HH0A 5LXYA 3O3LA 3A3PB 2W01A 2N3LA 3VGSA 4RR5A 2VBYA 2CG8A 4RU2A 1XNRJ 2KHDA 2G2YA 1U0SA 3MUMP 2IVFB 2I38A 3OQ2A 2HFNA 4GC7A 4H4KA 1JLCB 5ETPA 1EB0A 3UVJA 4F3QA 1H2VZ 2GAGC 2P2CB 1TKXB 2UV8A 2BJDA 1FNOA 4C6AA 3ENVA 3JB9k 5F8GA 1U48A 3KK3A 2B9WA 2LKZA 2OPPB 3EWGA 3AD7C 1NNDA 1WEZA 1WTFA 3MR3A 1RT3B 3RB3A 1ZM3A 3MCSA 2J6TA 2OMLA 5CCLA 1IBMF 2QA2A 2VOPA 4ILMA 1TK5A 3QAUA 3PV8A 4ED3A 1R31A 1SKRA 4A47A 2AYMA 1RCXB 2NXNA 1FHTA 3KNAA 3I5CA 1C1BA 1SIWB 1RCOB 2LQBA 2Y8YA 3DFEA 1F9EB 2F3JA 8AT1B 4C8MA 4KO0A 2F8MA 1DTQA 2ZVIA 4ZN1A 1VQ7S 4LF2A 1XC9A 1Q16B 1OSCA 3LF0A 2WVEA 1GTHA 4USWA 1T9WA 2J0XA 1NK9A 3R27A 1KHWA 3MPWA 3ZZPA 4BWMA 2M4MA 2ROPA 3QIDA 2IDLA 3PR5B 2CADA 2HNDA 4CYUA 1U02A 5FLXU 3MR7A 3SQGA 3MPYA 1FDNA 2YX7A 4JOUA 4Y28C 3QGHA 4IRCA 2QMXA 3MCNA 2V8PA 4QR1A 1BLUA 3MCMA 1Y3JA 2W1BA 3OTBA 5J2NB 3H2UB 1RYRA 2ZH5A 2LDYA 1V3ZA 2H9ZA 3HX9A 1MWQA 5KFQA 1NDLA 2XMVA 1U24A 3KJNB 1Y9OA 2IRYA 2VDHA 1WC5A 1JJCB 3MFIA 4YB6A 5B0GA 3LP2A 4FDFA 2IJNA 3OUYA 2I5JB 3EXCX 1HPZB 3VAIA 3GZ7A 1L3UA 1UVMA 3EICA 1XIQA 2MHEA 1GFWB 1AFJA 4NLGA 3LWLA 3FCWA 3I6PA 2WTFA 4URQU 2BANB 2YWKA 1TVRB 2X1BA 3BN4A 4NA2A 3QJJA 4JI4J 5F0WA 2QTWA 4A8XA 5THWA 3VVTA 3RRKA 4KY3A 4EZ6A 1IQTA 3D9BA 5AXKA 2ZH9A 2E5IA 1SPBP 2VQEJ 2M7SA 4Q7AA 4K5RA 4ZJLA 3GSIA 1H7WA 4DDFA 1ZS6A 1X4BA 5KT6A 3ZTRA 1S7IA 3CCSS 4WWSA 3O1LA 2ASLA 4USHA 4OIXA 2HQIA 1RHKB 2KVIA 4I6AA 8ATCB 3NMRA 3NCQA 4NI2A 4ED8A 5HMYA 4N5SA 2VOOA 2XY7A 2YKOA 3QFWA 2Q79A 2N3OA 1Q79A 2KM8C 4LQ9A 2HFUA 2WONA 3PHTA 2N4DA 3FSIA 1TMMA 2B6AA 4ES3A 5KT2A 4H4KC 4JI2J 5HSPA 4OV6A 1Y0HA 2JLEA 1SJQA 2EEYA 4ZLJA 3LH2S 2PDAA 1KLNA 4RNMA 2HG4A 2QA4S 2GV1A 1EX8A 4C8NA 4JI6F 1FA0A 4KH0B 4YMEA 4P2FA 4R8UB 2MKYA 3IBWA 2GHVC 2MKSA 3NXZA 2XWXA 3R5AA 1RUSA 2GGPA 1NEEA 4P10A 2NXEA 4B3OA 2QX0A 1SQEA 5K8MA 2DTJA 1RT2A 1ROFA 4B9VA 5E3CA 2UXCF 3NS5A 1ZA2B 1HW9A 3W65A 4ZIWA 4LBHA 3TWZA 1U2FA 2XNQA 2FJBB 2HZAA 2DISA 2MJNA 4QU6A 2YKMA 2ZJPQ 1UFKA 1Q5VA 2IIHA 5B0BA 3Q2TC 1RT5B 3CGIA 5E3RA 4LF7J 3Q24A 4O3NA 1SKSA 2M8HA 2OJ3A 1HWLA 3JYTA 4XIUA 2MKJA 1XNRF 3THTA 5KFGA 2AEMA 4K4TA 4K5SA 1MWZA 1N88A 1O5JA 4BWJA 2MMYA 4Z2XA 4JI5J 2G1HA 1RADB 2BOAA 5K8NA 2GO8A 4RW8B 1NJIT 3BDPA 2UVUA 4J90A 3BO2A 1KS2A 4O44B 1FJGF 2DO4A 3O6QA 3EZ5A 2GMJA 1LW2A 5H9EK 1R6YA 1DQAA 4ZHRA 3W3SA 3BQ2A 4F0MA 3OW2R 1GTEA 1N5YB 4EYIB 1IKWB 2UUCJ 1N0UA 3GV7B 1YIJS 4GVLA 5ETRA 1OSDA 1SV5A 2WOMA 5IWAJ 2HHVA 1HW8A 3CJKB 3FMBA 3H25A 1Q53A 4K4XA 2VU5A 1SL2A 3EMTA 4U8VA 5KT3A 3U1NA 5J1PA 4CLWA 1N8RT 1VS3A 3CDUA 2CPDA 1TL5A 2VBWA 4HR2A 5ETLA 1S7HA 1RT7A 1VBKA 2VG5B 2GX8A 2W7AA 1QAJA 2LXUA 1R3NA 3RBZA 5L46A 3SBMA 3VCDA 1HD1A 3MM7A 2VG6B 2X1GA 1WD6A 3CJ5A 4NXMJ 1IKVB 3MMBB 1F9HA 2BEFA 4FXWA 3ISNC 2Q3PA 3O8WA 2KXNB 2HQGA 1JKHA 2YNHB 3NS7B 4KKOA 1Z1ZA 3GCXP 2G0JA 4F2RA 1VRQC 2CJAA 3TA0A 3LP1A 2QSWA 3VGTA 1I51B 2H4YB 3SZ2A 3BPSP 4P72A 2P9CA 4TLRA 2AYGA 4UQGA 4I1TA 2CZ9A 2L08A 3CO9A 2HBRB 2XLJA 4QCLA 2RT3A 1YJNS 4ZITA 4GKKF 4X4NA 1X5TA 4B3SF 1B70B 2LECA 4PUOB 2UUBJ 2QSFA 4AD6A 2UZAA 1BQMA 4HHHA 1SIZA 1G6BA 3GLJA 4E2FB 3KWMA 4IOAQ 3MMJA 4DQRA 4RW7B 3LGMA 1FDBA 3VAKA 1S48A 2PI4A 3L09A 2VQEF 1LWEA 3CO0P 2MB0B 2DNQA 5A2QY 3OR1A 4C8ZA 2ATCB 2W2QP 1FWPA 4FPIA 3TW0A 2HLTA 1Q86T 1VK3A 1F0XA 2P9EA 3RUBL 4O3RA 3CCWA 1D3WA 2MQOA 5I3QA 3KLVA 2H5JB 4JV2A 3W2WA 1PC4A 1ELOA 3DRRA 2V9WA 2JX2A 2IRUA 5FDLA 5DQHA 5F8JA 5L1IA 2MJUA 4NEZA 1H7XA 4ZPTR 3D1QA 4ZVEA 2OKQA 3OVBA 2OEJA 3D68A 1U0HA 4F50A 4JI2F 4RNNA 4RWWA 5AXMA 1LWCB 5A2QU 3HF5A 2QYGA 3NNAA 3ZZOA 3PKYA 2IJRA 4RUAA 4QBUA 1VRTB 3ONQA 2J0QD 1FKPA 4YR3A 3SI8A 2B4OA 3D4JA 1FFSB 2EBEA 3KLGB 3KOAA 4ZCKA 5AT1B 2EW9A 1EQMA 2VH7A 1B0PA 5LMUJ 5LMNJ 4CCHA 3BB5A 3D2WA 1AA1B 1FVSA 4NYOA 2M0GB 3PG9A 2LEBA 1KQKA 3ZZ0A 2M52A 1ZPWX 2J6UA 1S9GB 3VZIA 3OFHA 3WC0A 5CYJA 5A8WB 4LF7F 1C0UA 2Z56B 4C0OC 3QRQA 1RI7A 3RYLA 2KT3A 3IWNC 1CJTB 1R8AA 5KFOA 3KFWX 3MFHA 4GRSA 3MTKA 1JLGA 3HP6A 4ECTA 5KFVA 2P8IA 1U1KA 4ZPVR 4C0BA 5LT5A 4ZK7M 2V34A 3CD6S 4PXCA 2OFHX 1HQUA 3CUNA 1FKOB 1TKZA 2UUCF 1SC6A 3KLEA 3KG1A 1UMJA 5CD4H 3NGTA 4DL2A 4YB5A 1F60B 3OJUA 4CI0B 1WDTA 5IWAF 3UWTA 3FK4A 4CLYA 4IG0A 4K0KJ 4URGA 3GV8B 3VGUA 3GTYX 5HMXA 3W9JA 4C3MA 2R2TA 2IA6A 1JLEB 1CQMA 4YP3A 3C15B 4NPOA 5A0YA 1PYTA 3JAMY 1WG4A 3CT9A 4RO0A 4BHQA 3ITHB 2OPSA 4Q8FA 3FEYB 2FJWA 4L6V3 3DOLB 1KLMB 1KFSA 3IA0A 4P75A 3HPOA 4CLSA 1RB0A 3K59A 2AV5A 3SDEA 3DRYA 4WZQA 2I2YA 1R8PA 2GIQA 3B82A 1YTYA 1WHYA 1UJ4A 3GILA 5DQGA 3HZEA 2DNPA 5GAEI 4HVZA 2B9EA 5KFMA 5KOWA 1BHNA 4Y65A 3QBCA 2WBRA 2YKAA 3IWXA 2E7VA 4NCBA 3ENWA 4X62J 1TQLA 2QN6B 4X66J 3CMAS 1NJXA 2VASA 5KG1A 4CLLA 1RWPB 5BYRA 3EJMA 2ABYA 2ZWPA 2RQCA 2DRDA 2SXLA 4NLVA 2FVQA 3G4SS 3JAMU 1CULA 1SI9A 4FVCA 4DPWA 1FD8A 4A8KA 3VTIA 4USUA 3OL6A 1M5VC 3TUJC 3BSAA 3RB6A 2KVQE 1NBEB 4OJGA 1FCAA 1VLOA 1CJKB 3M8SA 1K0VA 1NJYA 4TU8A 3WHIA 4UQTA 3C8YA 2XLKA 3BEGB 5C25B 1QSYA 1TFYA 5DG7A 2HURA 3H5UA 4LRBA 1VQ6S 2XI2A 2QA1A 2IVMA 2D9OA 1HNXJ 5C42A 4DUTA 2I0XA 4WU2A 3DLEB 2OMOA 4JUZA 1SUQB 1SJRA 3M7VA 1FT8A 1QE1B 4WFZA 4EU0A 4ZP6A 3B4DA 3JSMB 3GIMA 2GQQA 3MMCB 3OSNA 4LR7A 1X60A 4B3MF 3TJ8A 2PT0A 4NYPA 2DR6A 4HT7A 4P71A 5BR8J 2FVPA 3BZQA 4DPUA 1BXNA 4ED4A 4KGZB 2DD8S 1WJ9A 1Z2LA 2RRBA 5J2NA 3GFXA 4C11B 2FJVA 2DXFA 4YHHJ 4QR0A 3K7RA 4OYOA 4RW4B 4OJHA 4MYTA 2CWKA 2CDQA 4PKDB 2X1AA 1VQYA 1Y3KA 2VFTA 3K2YA 2ZWOA 4CH7A 4DXLA 1V3RA 2E5LJ 2B8QA 1TTHB 3PJ9A 4CTAB 2IBOA 3JTOA 2I5JA 4LFBJ 1LV5A 1MWYA 5D4PA 1XNQJ 1WELA 3H42A 3HI9A 5GAEU 2UVVA 5KFLA 3IG1B 4MFBB 3PW0A 1N48A 2QFIA 4IFYA 5FIIA 1NPPA 1C1CB 1HBUB 4KC5A 1I5OB 2DNOA 1U45A 1WKLA 2JHEA 3DM2A 2B43A 1PBAA 2LFVA 4RNFA 1SC1B 3Q86A 3OVAA 2ZOFA 3TZYA 5LMNF 4DFKA 2Y0SD 2VG7A 4K4ZA 2DNYA 1XTZA 5M2UA 4CNZA 3F73A 2D1CA 3NWRA 3MM6B 3TAPA 4A8YA 2HMIB 1JLBB 5CYMB 2LEPA 1P1TA 1MROA 2P5VA 1SJFA 4CH0S 5T41A 1FRMA 1R8BA 4JV1A 1K47A 1EIYB 1QVGR 5GAGU 2LP4A 3PRBA 3AA9A 4I68A 4WFNQ 3D54A 4FXDA 1A0OB 3EDRB 1NRKA 2OLWA 4WXOA 4DZDA 2P9GA 2XB2D 3THPA 3LA0A 1XMQF 3BGLA 3F56A 4RNOA 1RTDB 4DSIA 3PYGA 1KC8T 2GVDB 1AXQA 2W4DA 5KT5A 9RUBA 3UE2A 3UNYA 2DR9A 3IR5B 5KFKA 4A8MP 2AEFA 4M95A 1EZZB 4K2XA 4PQUA 1FNMA 5B0CA 5DDQC 4I69A 1L3SA 1RABB 4F3MA 1HBMB 3D1OA 2EFVA 1UPPA 2ALZA 2W8KA 4DR1F 4W90B 1RKIA 4NCAA 2ACMA 2VUGA 2BA9A 5HQ8A 3N6LA 2JZ5A 1HI8A 3L7UA 3JXOA 2IYIA 1Q5YA 5IM0B 3T1AA 2AT1B 2DHSA 3M4XA 2XYGB 5KTQA 1LOUA 1S6UA 2HHTA 1T9VA 1NXIA 3KHHA 1RT5A 4I64A 5A6PA 2I1RA 1DY3A 2RRAA 5F3ZA 3S6EA 1JIHA 1X8DA 2LQ8A 1YJ9S 4A8SA 1S5ZA 1VOMA 4ED0A 4Y2MA 1UWBB 1BE4A 4J9OA 5JVGQ 3SSQA 2FD2A 4X66F 5C5JA 4NRTA 4RW8A 2BE9B 4BS2A 3DLBA 2FZCB 5ETMA 1G2EA 4O44A 5FD1A 1T95A 2WSEC 1R0AB 4FF1A 3RG6A 1PJ7A 3AXMA 1YK9A 4ZLLA 1OWXA 3OHAA 5JMNA 1NZ8A 1N5YA 4DV3J 2FJXA 5B7WA 3W61A 3PR4A 3V5RA 5H9FJ 2XMJA 3QGIA 1OYEA 3MTJA 3CJKA 1X31C 2KG1A 2OSRA 3UD5A 1FDDA 3IO1A 2BABA 2K8GA 2HGNA 3PM9A 1RTIB 5KG6A 3BQ1A 3JS9A 3BS9A 3V6DB 3GONA 3BSOA 4YUDA 1DFDA 1HNXF 4I7FB 4P7TA 4AL7A 3DRSB 3AJ2A 1Y10A 3CCES 2OI2A 4E0DA 2VG5A 4NMLA 1JWWA 4MKVA 3CPWR 2DB1A 1ZZFA 4YN3B 3K5MA 3C14B 2E29A 3OD2A 1R0CB 1CEZA 2VG6A 2M3DA 2VB6A 5L9NA 1JB0C 4DV7J 3OL8A 3MAHA 5EWEA 5BR8F 4WP8A 4GO5X 4U7CA 2F8EX 1IKVA 3MMBA 1JJHA 2JNJA 1P9QC 5J2MB 4IR9A 3OPKA 5A8KB 3DOKB 2YNHA 4KYZA 1H2UX 1VQ9S 1PBUA 3LUYA 4JV5J 5ETOA 5J1EB 3MEEA 2R42A 4M5IA 3QAEA 3EGNA 1RHQB 3H4DA 1U1MA 5IT9Y 1WHVA 2MKCA 2GW8A 2MKHA 1Z2ZA 2E5LF 1U8WA 3LP0A 4R0EA 5J2QB 1UEUA 1Q81T 1NK7A 3DOMB 1KNZA 1S1UB 2RHQB 4OZ1A 4C8KA 3CVKA 4C9DA 4LFBF 4J9VA 1XNQF 1F1BB 4AUKA 1QJHA 5I3UB 2V2QA 1N36J 3M8ZA 1IKYB 3OXGA 1IQZA 1KDNA 2QE5A 2G4BA 1T9TA 2OEKA 3KNGA 3M30B 4J9LA 1J27A 3NAIA 4BC7A 1Q78A 3H7HB 4OX9J 1RT6B 1AUSL 5AJ3J 4RW7A 4CLUA 2HNYA 5RUBA 5IT9U 1T94A 5E3AA 1IXKA 4ED5A 2GJ2A 1TR0A 2NYIA 4XK8C 3ZTQA 5F8LA 1K9MT 3T19A 2V6AA 4NLDA 1NSPA 2M88A 4ETXA 2OUGA 3FNNA 2EG2A 1VGYA 3P5TL 2GFFA 1NKCA 3TQEA 1RQ0A 1GX6A 3P45B 5KFJA 3AAWB 1FO1A 4QYZJ 4TQRA 5IZHA 3JTNA 3T6BA 3I9V9 4NA3A 5IQQA 5BJRA 3RJMB 2QZ8A 4U67Q 2Z57B 2FY8A 7FDRA 1FFGB 1U1PA 4XDDA 4DI6A 1JX4A 3T5HA 1FK9B 5B09A 1T9UA 3DI6B 3M8PA 4OYBA 3NP5A 2YQ0A 3T1HF 1YI2S 3GJQB 4N8OA 1MN9A 1VRTA 3RAQA 2LXFA 2UU9J 3FRYA 3W62A 2LQ5A 5DO2A 3UW1A 4DX6A 2J7KA 3I5AA 5E5NA 2VFRA 4NLRA 1LXJA 2VDIA 4DR4J 3HVAA 3FVYA 3ZZTA 1QD1A 1UFLA 5DM7Q 2BKNA 2PFFB 4EZ9A 4X2BA 3MMAB 2ROEA 3MF5A 3MPDA 4I67A 4DFPA 3LANA 2CQPA 5D0RA 1T9XA 3EGWB 2V67A 1UPMB 3TA1A 1S9GA 1VC0A 3BDEA 3MPUB 5KFFA 2OIHA 5KG3A 2MPUA 1GMWD 4DR7J 4J5OA 2XCAA 5F0UA 1D8YA 1TV6A 4K4SA 4B3TF 2E9RX 2RD5C 3ILOA 2F63A 2OD6A 5L9XA 1M5PC 4LRCA 1TKDA 1JXEA 3DHWC 3I82A 3MI7X 1S1WB 4USMA 3GP9A 3QGPA 1A7GE 1PAEX 1VQNS 3EVWA 2AYEA 2ZFHA 3C66A 2R7WA 2HS4A 4A8FA 3J7ZT 2V69A 4MK9A 4DR3J 3QT6A 1KD1T 5JXSA 3KTQA 2EFNA 3LGNA 1I94J 3D3CJ 4DFMA 1Y00A 2H5IB 2A2CA 4OHXA 4DV3F 1ZM9A 2HZVA 1FWLA 2DR8A 1VMBA 4WXWA 1Q1KA 1X9MA 4DPTA 1WSRA 2BXJA 5DRKA 1S4FA 3N5FA 3TUZC 4B08A 3AD8C 2XLIA 1ITPA 4OHWA 1EARA 3IR6B 4QU7A 2J9CA 1JLEA 3N01A 4KHMA 4DWIA 3UI3A 1FXDA 3ITHA 3QYYA 1FXLA 4O4RA 2UUWA 4M5GA 4CDIA 2XQCA 3OVSA 2O67A 3UNGC 4Q43A 4U9RA 2G0IA 1ZTWA 3RZAA 4MT1A 3NY0A 3BBFA 5EX3A 3D66A 3KLIB 3OHBA 3WC2A 3BH6B 3Q2SC 4Y3CA 4L75A 4DV7F 3PW5A 4ZP9A 1RDRA 1UEKA 2MQMA 5CA5A 2E7WA 4LBIA 1X7VA 2V2KA 1U1LA 2HLUA 2UXBJ 3HFVA 2UP1A 2LEAA 5CYQB 3IRXB 4JV5F 1B7YB 2DT9A 5EUHA 2UVWA 2ASDA 2IM3A 3OFFA 2CPHA 2WVCA 3EGVA 1KEKA 2HHPA 1LFWA 3GPAA 2EXUA 2F5GA 4FKYA 5D0GA 3HCXA 5KFHA 4PXEA 2DH7A 2YKPA 1D09B 2XZWA 2W9AA 1UVIA 1N36F 1W2BR 4KPYA 4RLEA 4FS2A 2DCLA 2XMAA 1ZA1B 5HQMA 1YGYA 2LMIA 3DLEA 2ZZMA 4E98A 3RTVA 3L3CA 2R9LA 1PILA 1QE1A 4TLQA 1X4EA 3R97A 1IM4A 2R8IA 4OX9F 3MMCA 3P3DA 2K7KA 3A3OB 3KUEA 1SVDA 1XMOJ 1EJ7L 2WVDA 3GWCA 5T7LB 1VQMS 2H65B 2XULA 4USVA 2AX1A 2N7YA 2XMTA 2KXFA 4EO6A 1KBRA 4OX8A 1YSJA 3WX8A 1EKSA 3KK2A 4C11A 2CRLA 3BF4A 1O8BA 4YEAA 2C3YA 4RW4A 4HACB 1GT8A 3OL7A 4FS1A 3DDIA 2AP6A 2BM0A 1GXLA 3I55S 2VA2A 2DEJA 4CTAA 1SB6A 4MAKA 1AT1B 1U6ZA 2MY8A 1FRJA 1WKJA 3NNHA 2O3DA 2IDEA 3J7YI 3DMJB 4Y2KA 4LFAF 3IG1A 3FZ2A 2N7CA 1N5SA 1H73A 3MCOA 4AL6A 4MMOA 1KP6A 1WG1A 1RA6A 1YQHA 4WFAQ 1HNVB 1H2TZ 2UU9F 3DYAB 3E2EA 1W2IA 1C1CA 4FF4A 3BQ0A 1PO6A 2KRRA 2QT7A 2HK3A 4YDDB 1DQ8A 4DR4F 3RGIA 3QSIA 1L3TA 2CNOB 1YJRA 4ZVGA 4NA1A 3CMQA 2PN6A 2Y1JA 3UDLA 4EWTA 1V6HA 3BYPA 2JRSA 3DXSX 1HR0J 4P2SA 4WKYA 2DNMA 1S6QB 1KTQA 2K3IA 3MM6A 1RA7A 1Q0NA 1OJ4A 4Q5VA 5CYMA 2WW8A 3GIIA 6FDRA 2EK6A 3KK1B 4DL5A 3LOUA 3BGUA 1PJ6A 2HWHA 1VIOA 4DR7F 4QJVA 2RNEA 2JFDA 2V8GA 2PGCA 1NDPA 3NS6A 1XBWA 4LRAA 3D6FB 3I87A 2Y3YA 1YZ6A 5IV4A 1NKEA 2DNRA 4N41A 1X0PA 3IC1A 4PWWA 4HDGA 4KHPJ 5I42A 1RTDA 3T5KA 2GVDA 2QLBB 1S1XB 2CJKA 1GMVA 2YX1A 1FJCA 4DR3F 1HNWJ 3CJ8A 3DLJA 2HHWA 4IH6A 3QQCD 2HVIA 1QLNA 2MGZB 2R2RA 1F6TA 5E2QA 1JK9B 2F8HA 2DYAA 3WBZA 1HNZJ 4X64J 1HBMA 3NOGA 3J81U 3GG0A 2B5JB 3ZNUA 4NWBA 5E41A 3W1YC 3TUIC 4BBYA 2NZ4A 3PX0A 1NDCA 5B0FA 2ZDPA 2HEKA 4X65J 1IBLF 1N33J 2RKIB 1R8HA 2GQ2A 3TYTA 3ETMA 3PXGa 2IM1A 5ADZA 2KKHA 4USIA 4O4GB 3J7YU 2DPIA 2M70A 3MUVP 2YWHA 3A8IA 5D8HB 1Y5IB 2WAQD 4FZVA 3QO9B 1N6QB 1UWBA 2VV5A 4WE1B 3UDEA 3M6VA 2HBZB 3TANA 4RUBA 4DG1B 2BRLA 3CJ3A 2VQFJ 3Q8PB 2A0FB 4F4AA 4B3RJ 1RLDA 3FBFA 2HBYB 4NMXA 2Z2YB 1R0AA 3J7AN 3HT3A 3UN3A 1KVJA 3K0JA 4ZVOB 4M63A 2VC1A 3C16B 2BE2B 5HJXA 4Q45A 3MEDA 5IC6B 4AFFA 7AT1B 3AH6A 2LDIA 3N28A 3OFGA 4V19X 1IN0A 5M2RA 5HL7Q 4C8OA 3AY0A 4G1PA 2KDOA 5DS7A 2RDJA 5KFBA 1P6TA 3GG1A 3CDWA 1WOPA 4IDKB 3UR0A 4NOHA 1S59A 2H4WB 2VFSA 3VWSA 2IC3A 3DRSA 1KRPA 1CJVB 4HT5A 3DNCA 2JDJA 8RUCA 4KTQA 1T8EA 3MXHP 3C14A 4KB7A 2D69A 4QPXA 1XMOF 3TZZA 4DQPA 4OHYA 2BDPA 2YX4A 1OYDA 5KG5A 3PHEA 1O0PA 4PG7A 3IP0A 1T9YA 2QL7B 4DF8A 5J2MA 4UT4A 5A8KA 5KFXA 1NM2A 4KGMA 4V1Ak 3DOKA 1TUVA 1BGXT 1SH3A 2IFXA 3CNQP 1UTAA 2AYBA 1YX2A 4NLYA 4OHVA 1SH2A 5J1EA 4C3KA 4R5PB 2CPFA 1URNA 4QQBA 2GJFA 4ILRA 5J2QA 4ZP8A 4MJKA 2XO6A 3DOMA 3EVMA 1AYEA 5I3UA 3SCJE 3GCWP 1RWOB 5MLCV 4N77A 3TR5A 2CPIA 1IKYA 3QSYB 4ZVSB 1GQEA 1IBKJ 2VICA 2X1FA 4LSNB 3MAAB 2ZHBA 1RWNB 3EZOA 4ZPBA 3SQOP 1VQPS 4RBTA 2VBZA 3D0HE 2BJ3A 4TU7A 1N4LA 1RT6A 3UR3C 1N32J 2ZH2A 3GIKA 3B8HA 1MMNA 4CO3A 5ETQA 3H98A 3NMAA 2MXYA 4WCEQ 3VVUA 1K0TA 1CS4B 5F9NA 1F5BA 1NZAA 5CZXA 4DN9A 2RIJA 2V8VA 3IM8A 4ITSA 3R5JB 2ERRA 4GVBA 3HHEA 4DBQA 2DNGA 3R7NB 3OLBA 4ZKAA 3RR8A 4DV1J 2HYIB 2KO1A 2ZEJA 4F4WA 3NCPA 1P27B 2KFNA 1REVB 4ZP7A 1PYSB 2ZVSA 3V2UC 5HK4A 2DGQA 1VFJA 3HT0A 4X4OA 3W2VB 1RISA 3AOAA 3O2IA 2E9TA 3I56S 4TQSA 3FBBA 3G8SA 1RAAB 2DGVA 2X7IA 3ZZZA 1RBOB 4KHPF 3PNIA 4HLBA 1FK9A 3DI6A 2CQCA 3D7SB 1DJ0A 2GIFA 5L1KA 1G3OA 2G2OA 2NREA 3FFIB 2NPFA 2CAJA 4P9SA 1NDKA 1HNZF 1WC3A 4X64F 2ZE2B 2QLFB 3P96A 5H1SV 3J7A1 3TAQA 3HXMA 1I1GA 4P73A 4EK2A 1HBNB 3AJ1A 4X65F 1N33F 3MMAA 1HI0P 3A1YG 2A2DA 2J0SD 4PEOA 2FZGB 1SCJB 4H4OB 3P5BP 1W26A 1KFDA 3KUHA 3U27A 2RHSB 2DO0A 4QWBA 2NXJA 3L9ZA 1F5CA 1U1RA 4KJIA 3DDKA 2X3DA 1J5OA 1IVZA 1RWUA 3ENAA 3ULHA 2RAQA 1MU2B 2QEXS 1LW0B 4WPAA 1QDUB 1WTBA 1QUVA 2G9OA 2VL1A 4DX5A 2K1RA 4DQQA 4AXJA 2C2DA 2C2EA 1FKAF 1U2RA 1JXVA 4AE5A 2ZDOA 1S1WA 1BY9A 2XC9A 4G1IA 2VQFF 4L72B 1HWUA 3F41A 4NZ6A 2ZJQQ 4X84A 2JVOA 1OS5A 1WG5A 4IQMA 4URSA 1QTMA 2BBEA 3D6MB 3CCJS 5LJ5Y 4P74A 2FYXA 2VBXA 2IRXA 1HHQA 3AB2B 2HZCA 1TL3A 3R1HA 2UVRA 3ADAC 4CO1A 2DXEA 2Y0BB 1TL1B 4NE9C 1RU2A 3MHYA 3KHLA 1U49A 6AT1B 3MWBA 2XZDB 5EWFA 2C22A 4O3QA 1HWIA 1S9EA 3HVWA 2Z58B 1VI7A 4F3OA 1HIYA 3IGVA 4F7VA 4FBTA 3TVYA 5ETNA 5D4NA 3TAMB 2W9CB 4N76A 4KR0B 3A8JA 2MY7A 3LAKA 1JLAB 2QLWA 2UXDF 5DGBA 1VQ8S 3Q23A 1RSCA 2WHOA 4ECQA 1KN6A 2DIUA 4NXNJ 1JLFB 4DU7A 5EWGA 5LM7E 3KMSA 4OQJA 1JXLA 1BMQB 3M8QB 5GMDA 1NKBA 4K7QA 3IRXA 3BREA 4IFVB 3VQSA 3HD1A 5KFEA 2CQ0A 3CC7S 3E3XA 1UJ5A 2BX6A 3OBIA 2WB1D 2GVZB 3V81B 4ZN3A 4J9QA 1U26A 3QIPA 3DRXA 4DL6A 4RKUC 2DH9A 3VHQA 2XSJB 3S1TA 4RW9B 2PO4A 2QA4G 4ZVRB 1L3VA 1VDHA 3W5XA 4ECSA 4CRJA 1KHVA 1BC6A 1IR2A 2CQGA 1X9SA 1KKHA 1W7WA 5HANA 1QM9A 4HKQA 3M2RA 4LR8A 1SL1A 1AFIA 2ZH4A 3VAFA 3EGZA 4A8WA 3J7Z5 2CNKB 4M94A 1IBKF 5L1LA 2ADCA 3KJFB 1VJQA 3H59A 2H48B 1X0FA 2Z4PA 3Q8VA 4ECXA 2DIVA 2CPYA 2R7SA 2Z0GA 3X3UA 1NH7A 5F3TA 5EHHA 1N32F 1T02A 1HMVB 4KH1B 2ALYB 2QG9B 5T7LA 3M9NB 2F9DA 4K4UA 2KM8B 3PYDA 4DUZJ 3TUPA 3ZO7A 4ENOA 1MN7A 1OMSA 2AX0A 3UVJB 3TJAA 2KJVA 4DEZA 3I0SB 4BDPA 3CCMS 4TU9A 4ANCA 4ELTA 1HKAA 5HJYA 4HACA 1OPIA 1W25A 2HHXA 2F40A 1TL7A 2LU2A 2ASYA 4DR2J 4ED6A 2IM2A 4MKAA 2XS7A 2H5EA 4M5DB 1WF0A 4DCJB 5ETVA 4NLQA 1U6BA 3IAS9 4JI1J 2YTCA 3K5PA 2MQQA 1VBZA 2JWNA 3N4WA 4QIWD 1GEHA 1C1BB 1HWJA 4K2JA 1FRXA 3NRBA 4USTA 3QNWB 2JL9A 1HNVA 3W7BA 3DYAA 1UVKA 1U1QA 3I9ZA 4LR9A 5CHCB 4WF9Q 3KDNA 3DN9A 2VPZB 2YNGB 2RDDA 1RWXB 3NL0A 5F8IA 2AJ1A 5A8RB 1RZMA 2AHOB 5F9LA 3G96A 1S6QA 1ZOTA 1B64A 1NCLA 2BJ8A 3GYNA 3M6WA 1T3OA 2DXDA 1NLKL 5DG8A 3IS9B 3A8EA 2HHHJ 4B9LA 3OV7A 3RR7A 4IOBA 2BM1A 5J2PA 1X4CA 3KYLA 4DL4A 4HYKA 1OY8A 3KK1A 5C24A 1GK8A 4MK7A 2H3EB 2D3ZA 3TJ9A 3LPYA 2C42A 1WC6A 3D0GE 2AJ0A 4DX8H 1N34J 3AJDA 2LU1A 3R5CA 4UF4A 1S6PB 3AFGA 5D4OA 2RQMA 2VJUA 1VQOS 3O5TB 4KRWA 2B56A 3OTOJ 3LALA 2FHJD 2AGOA 1M5OC 5KG7A 2OSQA 1MLAA 3PRDA 5HI7A 3CD0A 1XJWB 3MEGA 1VRUB 5AXNA 1H6KX 2DGXA 2AGPA 5KFWA 3RU0A 1ICEB 3NGKA 1NK5A 2HAIA 2MGZA 4ZOSA 4ECRA 1H98A 4OLPA 2B5JA 3CE8A 2YVSA 3CCVS 3UD4P 1CQNA 1DLOB 2RJZA 2W25A 3K8VA 2BRKA 2XGQA 2ZNZA 5IC4B 3M6XA 4ZDNA 1CVJA 1S99A 2E5JA 2XNRA 1Z4UA 2CQDA 2YPYA 3C46A 2WW4A 1WC1A 2DPJA 3ZTOA 2F1FA 1VQ4S 3HO1A 5L39A 3KHGA 3G2XA 1RHJB 2FHMA 4O4GA 4LIRA 4AXIA 3MR6A 3UD3P 3KLFA 3HSZA 3HSGA 3E8OA 1FVQA 3SSRA 1R89A 2V9KA 2MSSA 1QTNB 1M1HA 1HWKA 4OI1A 3FRZA 1S1TA 1D8ZA 3SCLE 4NXNF 4DG1A 3RW7A 3M9OB 3UN5A 1HLWA 3PZPA 3VQTA 1Q8BA 2DNNA 2B6AB 1RTHB 1UW4A 3W5YA 3B4MA 3CC4S 2AZ3A 1ZAVA 4A8QA 1H38A 2BE2A 4XDCA 2MZ1A 3CW2C 4DJBA 4HI2A 3H5XA 5EGYA 4AL5A 2KL8A 5SZTA 3NBPB 5GAHI 2DGSA 4ZPDA 4CZCA 2PA8D 5CABA 2CUYA 5JJBA 2R7OA 2ZBQA 5DJBA 1SL0A 2YNFA 1JJ2R 2ZM6J 4IDKA 3G9CA 4CO0A 2IHR1 3C6TB 3RBXA 2GHPA 3V6JA 1HQ2A 1BD6A 2YKMB 1CJVA 3NAHA 5K9FA 1XMBA 2ZHOA 2O5DA 3U02A 4HI1A 1YVFA 1E6VA 5KFIA 2ZUAA 5GADI 2RS2A 3CIZA 1WSVA 2GZOA 3SFGA 2J5AA 4I2QB 3UCGA 4F67A 3HHLD 5L8RC 1CG2A 2W7OA 1S6OA 4TVAB 2IBKA 2FC9A 4PRFA 5EDWA 1FXRA 3B54A 4UUXA 1WOSA 3AQOA 1D9FA 3QRPA 4Q0BA 3PEJA 1Q8LA 1RTZA 3TO8A 2XHCA 3G82B 1WC4A 5DZ6A 1EETB 4C4WA 4DQIA 4NASA 5G0RB 4OHZA 3ET6A 3NCRA 1DTTB 2MZSA 1FTRA 3R9LA 2ZZTA 2N4CA 3CJTA 4OYXA 4ZHRB 2KYXA 4KBIA 3I0RB 4LVNP 2CQ1A 3K58A 3IFEA 1TAQA 1FERA 2OH2A 2PEHA 3BKUA 4JI1F 3LTOA 2QJ3A 3G6YA 1N52B 4JI4F 2WOMB 4LF5J 2AIRB 3F0NA 1HHTP 2Z2ZA 2RUGA 3EXYA 4KPCA 3NWGA 3AHPA 4BLGA 3QJLA 3DGPA 1UZHA 3MAAA 3TNVA 5B0AA 2ZH8A 3NKYA 3BH7B 2RQKA 3TVKA 4B9UA 1UVLA 3HVTA 1V3SA 3D6TB 4OLOA 1T05B 7FD1A 2YNIA 4USJC 4DV0J 2NQPA 4J9NA 4CO2A 4LJMA 3GJSB 1CS4A 2BW2A 3AT1B 5GAHU 4F8RA 2J9DE 1UEVA 2FGOA 2HHHF 3Q8QB 2IYGA 3R2CJ 2JEFA 5KFTA 5KFNA 1Q95G 3N5BA 3NGRA 4PXDA 1P9YA 2R7UA 2E1PA 2CJ9A 4DSEA 2RF2A 3BBCA 2AF6A 3HJVA 1REVA 4F0HA 1RAJA 1N34F 2J8AA 5KG0A 1LWXA 2V63A 2HHQA 2HRTA 3ZZRA 2YY3A 4I6YA 1M5HA 2E5HA 1WHXA 3Q22A 3W2VA 3BBBA 1S76D 1WUUA 4C97A 3KJVB 5GADU 4ECZA 3GFHA 5HMWA 2HFVA 1WEXA 1RAGB 2FDNA 1IM6A 1Q7YT 3K5LA 2J8SA 4OJ3A 5K14A 2RUSA 1NMEB 2OHDA 2W4PA 3GJTB 3W66A 1S79A 3POTB 2RE1A 1G4CA 2CNLB 1P1LA 2YH1A 3FFIA 1TUGB 4Y2CA 4A8OA 2V4JB 4LF4J 2ZE2A 2K06A 5D6GA 1HBNA 3L7PA 4PQAA 2QYCA 4GO7X 4X4TA 2H1YA 2DNLA 3H90A 2PA3A 1ZH5A 4G1QB 3LGHA 2CZ4A 4IG3B 3IBCB 5M2PA 4H4OA 4FYDA 3OR1B 3W8GA 1IJFB 1BUXA 1VQLS 2B0GA 1OY9A 3L7OA 2PI5A 2DBBA 2XMMA 2O66A 2CKWA 4U95A 1SQFA 4ECVA 4JI5F 1FRKA 2KH9A 3G6VA 4EO8A 1WI6A 2AQ4A 4E8UA 1WF1A 2JFKA 1BQNB 1FDAA 1LW0A 1HI1A 4TY8B 3W2WB 4ZVPB 4YQWA 4ZLNA 2NS1B 5FDLB 2R8GA 2HIQA 1RJJA 3W5ZA 1BWVA 4HDHA 4NLOA 4DR6J 3ZZUA 5DM6Q 4RX6A 2IY5B 1U0HB 1V5IB 3QWPA 3ZC4A 4M5KA 5H9FK 3NEKA 1WF2A 3KXDA 1QVFR 2V4RA 3VAGA 3FZBA 3JQJA 3KKFA 1FI4A 5IT0A 2RILA 1XR7A 2D3UA 4DX7A 2NUUG 3QZ8A 1FKPB 1LWFA 1FD2A 2CPEA 2OTLS 2DGOA 2XGPA 1WEYA 3CEDA 1YJUA 3UQSA 4IYQA 4EYHB 1KOOA 4L73A 1SJ4P 1HYSB 2NSBA 2VONA 4ZIVA 3WX4A 1YHQS 2C2NA 1UVNA 1JLQB 1JLCA 4NXMF 3M9MB 4EMDA 4PPZA 5HBMB 3AXKA 3TAMA 2UUAJ 5C2CA 1NSAA 1TKXA 2XMWA 4ATNA 1NSQA 2IMWP 4MIWA 2BQUA 1JLAA 5FJ4A 4OYAA 5KG2A 2BKPA 4DFJA 4C2MA 3H2VE 2OPPA 3R7BB 1BWEA 1GMUA 4C8YA 2E44A 2W4CA 4FN5A 1RT3A 4Y2AA 2XCPA 4MIBA 2BJEA 2D3OR 2R4FA 3CULA 1OQ3A 1JLFA 2MDAA 1JLGB 2HS3A 2CQIA 1F9FA 3BM7A 3DLGB 2NXUA 4IFVA 2ATLA 2HW3A 2B4PA 2BVZA
chains in the Genus database with same CATH topology
1ZPVA 1NJZA 2APOA 2E1RA 2DNMA 4WKYA 1N54B 1GTEA 2RU3A 1S6QB 1N5YB 1KTQA 4EYIB 1IKWB 2ZZNA 1N0UA 2K3IA 4RUCA 2VKRA 3GV7B 3MM6A 1RA7A 4OI4A 3M2UB 1YIJS 1X9WA 4B02A 1OSDA 1SV5A 2OAUA 2WOMA 3OFEA 4ZPWR 4Q5VA 5CYMA 5D4LA 2HHVA 1APSA 2MQLA 1HW8A 2WW8A 3FMBA 4U7UK 3CCTA 3CJKB 3GIIA 3H25A 2HRYA 1Q53A 6FDRA 4K4XA 2EK6A 3HDSA 4O23A 5CCMA 3M8RA 2FVCA 2UUBF 1Y4ZB 2DGWA 3KLEB 3KK1B 4DL5A 2W8LA 4DSKA 5GAGI 3LOUA 1SL2A 3WZ0A 2JEJA 1XERA 3MM8B 3BGUA 3DLKB 2HWHA 1VIOA 5KT3A 4YOEA 5J1NA 3U1NA 3UCUP 2FY1A 4DR7F 5J1PA 4QJVA 5HO4A 4LF5F 2RNEA 1N8RT 1VS3A 2JFDA 2V8GA 3CDUA 2CPDA 6FD1A 1YJWS 2PGCA 3NS6A 1XBWA 3HFKA 2D9PA 4TYBA 3I87A 1TL5A 5DLGA 4B3RF 2VBWA 2HHSA 4ICLB 4G6VB 4PR6A 1S7HA 1RT7A 1QSSA 4CT9A 2VG5B 2KT5A 4Q8EA 1YRUA 1NKEA 2GX8A 2W7AA 1QAJA 2DNRA 2LXUA 5HROB 1R3NA 5AXLA 1JJ4A 1JJ2R 4N41A 4EBDA 2BACA 1X0PA 2FUG9 4X4PA 5F8HA 1S0OA 3IC1A 1ZM2A 2OP5A 1DARA 4HDGA 4OMFG 3VCDA 4N56A 5I42A 1HD1A 1RTDA 3MM7A 2PE8A 4ETZA 3T5KA 4DN0A 1S1XB 2VG6B 2X1GA 2CJKA 5AE2A 1WD6A 2KFYA 3PJWA 2Z2MA 5DDOC 1HMVA 2YX1A 4F2SA 3SDEB 4DV0F 4DS5A 1FJCA 2V94A 1EP4B 1GNKA 1RT1B 3CJ5A 4DR3F 1N5VA 3DLJA 2HHWA 1RTJB 1IKXA 1IKVB 1NO8A 3JTPA 3MMBB 5HN0A 4FXWA 4IH6A 3ISNC 2HVIA 2Q3PA 1YG0A 3O8WA 1QLNA 2MGZB 2R2RA 1B7FA 1RK8A 5E2QA 1JK9B 2KXNB 1JKHA 2F8HA 4ID5B 2QIFA 4I2PA 3H20A 3I32A 4C98A 2YNHB 3WBZA 1DZ5A 2ZKTA 1ZAXA 3CDAA 4NLXA 1HBMA 4DPOA 4KKOA 1Z1ZA 2QMWA 2EWHA 1HA1A 2B5JB 3GG0A 4NWBA 5E41A 1RYSA 4F2RA 3MDFA 2CJAA 2G1DA 4WTYA 3TUIC 3TOQA 4BBYA 3PX0A 1FJEB 2NZ4A 3I0SA 3TA0A 3LP1A 3VR1A 5B0FA 5BYSA 2QSWA 2ZDPA 4KFBB 2HHUA 2W9BA 1YITS 1IBLF 2EFOA 3SZ2A 4B9NA 2ILZA 5L1JA 2RKIB 4ZA1A 2ZH6A 5JVHQ 1VBYA 5KOXA 4CO4A 1HPZA 2A3JA 2P9CA 1R8HA 4TLRA 2GQ2A 2AYGA 4UQGA 3TYTA 4I1TA 2L08A 3CO9A 2QRRA 3H5SA 3KLHB 1N5TA 3PXGa 2IM1A 1E6YA 2XLJA 4M5DA 5ADZA 4QCLA 2BANA 2RT3A 4OZJA 3KLIA 1YJNS 4FF3A 2KKHA 4GKKF 2MZRA 5GMKa 3R3TA 4USIA 4J9SA 4O4GB 2L9WA 4GMKA 3J7YU 1VIXA 4X4NA 2DPIA 1TVRA 2M70A 4IH7A 4C0HA 5FLXY 3MUVP 1X5TA 2YWHA 3RW6A 4B3SF 3U1LA 2VPYB 1C0TB 5D8HB 1Y5IB 4Q2MA 3LO3A 3CTRA 2LECA 4Y6IA 2WAQD 4FZVA 4MKYA 4PUOB 1JMTA 4FPRA 3QO9B 1N6QB 1UWBA 2QSFA 4DL3A 3DLLQ 1NHUA 2UZAA 4DHVA 2R7TA 1UA0A 5CYQA 1BQMA 2VV5A 1J5OB 2HFOA 5LMUF 4WE1B 1SIZA 4M8LA 1G6BA 3TVZA 3M6VA 3TANA 4QYRA 4OZLA 5IQ6A 4RBVA 1H0HB 3ICLA 4DG1B 1RP5A 5CZVA 3KWMA 1TKTB 4CH1A 2BRLA 4IOAQ 3MMJA 1D9AA 3CJ3A 4H4MB 5CQGA 5C42B 1GX5A 4F4XA 2YKNB 4TYAA 4DQRA 4XPCA 3Q8PB 4RW7B 3LGMA 4UOCA 1FDBA 3VAKA 1S48A 3V4IA 2PI4A 3LQVA 2YNGA 3L09A 3NLCA 4LF4F 2VQEF 1LWEA 3IAM9 5GVQA 3K57A 1R0AA 3OR2A 2E7XA 4PG8A 2K1RB 2MB0B 1X5SA 3HT3A 2VC0A 4ALZA 2DNQA 5A2QY 1KVJA 4EGLA 3K0JA 2J9EA 3OR1A 4C8ZA 3CD5A 2KRBA 4M63A 2VC1A 3ISZA 3TW0A 1S9FA 3SV4A 2BE2B 5A8RA 4Q45A 2HLTA 2LYVA 3I4PA 3V6KA 2J6SA 3FEXB 3ISND 3MEDA 4J9RA 2OPQA 4AFFA 1N56A 1LKZA 2PIIA 2KN4A 3AH6A 1Q86T 1VK3A 1WI8A 2C3OA 1F0XA 2LDIA 2P9EA 3N28A 3OFGA 3IS9A 2YH0A 2LVWA 2BOPA 4V19X 1IN0A 5M2RA 3VZHA 5HL7Q 4I4BA 5DG9A 4O3RA 3CCWA 1D3WA 4C8OA 3AY0A 4G1PA 2KDOA 5DS7A 2RDJA 2HNZA 5KFBA 3UCZP 2KHCA 2MQOA 1P6TA 4Y34A 5I3QA 1R43A 3KLVA 3PW2A 2ILYA 4JV2A 4J37A 4WYWA 3W2WA 1PC4A 3GG1A 1ELOA 3CDWA 1TL3B 2NPIA 2XMKA 3DRRA 2V9WA 2JX2A 2IA0A 2IRUA 4IDKB 2IMOA 3C6UA 1VLYA 3UR0A 2CQ2A 5FDLA 5DQHA 5F8JA 2HS0A 4NOHA 2YQ3A 5L1IA 4DR5F 2MJUA 2VFSA 1H7XA 3VWSA 4ZPTR 1S6PA 3H4BA 3D1QA 2XS2A 4ZVEA 2OKQA 3G6XA 2IC3A 3OVBA 3DRSA 5L38A 3C2PA 2FJDB 1RGVA 1KRPA 4HT5A 3DNCA 5K8PA 4F50A 4JI2F 2JDJA 4RNNA 2QV6A 1K1SA 4RWWA 5AXMA 1FJ7A 4KQZA 3G8QA 1LWCB 4KTQA 2C3UA 3DU5A 3HF5A 3NNAA 4R8UA 3ZZOA 3PKYA 1T8EA 3MXHP 1S9EB 4KB7A 4RUAA 4IQXA 4QBUA 4DR6F 4B9MA 2AJQA 1KR4A 2F9JA 3M2VA 2XWYA 4QPXA 3MUTP 1XMOF 1D9DA 4W92B 2ZH1A 3DCAA 1VRTB 1VRUA 3C3LA 3ONQA 1IJEB 4F4ZA 1G7CB 4DQPA 4OHYA 3SMZA 2J0QD 1FKPA 2ZD1A 2BDPA 2YX4A 4YR3A 3BN7A 1R8CA 4TXSA 3MPVA 3SI8A 3U7JA 2B4OA 5KG5A 4K0KF 5EN1A 2EBEA 1IR0A 1O0PA 3PHEA 4PG7A 3KLGB 3HHNB 4ZLPA 4ZCKA 5IFMA 3FSXA 4DV1F 4DF8A 5J2MA 1Q7LB 2HWTA 5A8KA 3KK3B 5KFXA 4KGMA 4IFYB 3X1LB 2EW9A 3DOKA 3N6NA 3OW2R 4YDXA 4AYBD 2VH7A 1TUVA 1L5UA 1BGXT 1SH3A 1B0PA 2IFXA 3H40A 1L3KA 4R25A 3G71S 4CCHA 2AYBA 5LSRA 3BB5A 1DLOA 3DM2B 4NLYA 4OHVA 2L3MA 3D2WA 1BQXA 1SH2A 4PWUA 4QZVB 2A18A 2XBPA 4HTIA 3HZGA 5J1EA 1Y5LB 1FF2A 3PO4A 2YWGA 1FVSA 5E33A 4NYOA 2M0GB 2FVSA 1M5KC 2LEBA 1YRTA 2DHAA 4C3KA 1KQKA 4R5PB 3ZZ0A 2CPFA 2M52A 1NK8A 1ZPWX 1URNA 2J6UA 1S9GB 4NRUA 4QQBA 2KT2A 2VG7B 3VZIA 1T03A 4OI2A 3US5A 3CCRS 3OFHA 3WC0A 4ILRA 5J2QA 5CYJA 3MR5A 4ZP8A 3DMJA 2HVHA 1R7IA 5A8WB 4LF7F 1C0UA 4MJKA 3DOMA 4C0OC 3E01A 4JI8F 4RW6A 3CCLS 1RI7A 2P6TA 2CQBA 3RYLA 3QIPB 2ZNYA 4OZNA 2KT3A 3IWNC 3PX4A 3SV3A 3M1VB 1R8AA 4KO0B 5KFOA 5I3UA 1DTQB 4X62F 3SYZA 3KFWX 4JBCA 2B4VA 3SCJE 2KJWA 2EVZA 2UV8G 2UUAF 5MLCV 1WNEA 1MROB 4N77A 5SUHA 3TR5A 2CPIA 2JOQA 1IKYA 3M32B 5EX0A 3H5YA 5CXTA 4KHRA 2FHOB 2RU9A 3I31A 4UW2A 3MFHA 1GQEA 1AROP 4OX6A 3GIJA 1TZ0A 3M2RB 3MTKA 2X1FA 4LSNB 2ZHBA 1JLGA 3BO4A 3HP6A 4ECTA 5KFVA 2VPWB 4OV1A 4K50A 1QY7A 1K8AT 4HHJA 1U1KA 4Y00A 3PIPQ 4ZPVR 3BJYA 4C0BA 4ZPBA 4BC9A 4NCGA 1VQPS 4RBTA 2VBZA 5LT5A 1NAQA 3D0HE 4TU7A 4ZK7M 1N4LA 1IKWA 1RT6A 3UR3C 2HNDB 2ZH2A 3PW4A 4OFZA 4RZRA 3GIKA 3B8HA 3CD6S 2Q43A 1MMNA 4CO3A 4PXCA 2OFHX 3H98A 3SQGB 5CH7B 3NMAA 1RTHA 2MXYA 1HQUA 1SKWA 3CUNA 4WCEQ 1U7LA 1K0TA 1FKOB 1FRLA 3T6JA 3BSCA 1TKZA 2AU0A 5F9NA 1F5BA 1SC6A 2UUCF 1NZAA 3KLEA 1U1NA 3DRPB 3KG1A 5JUMA 1UMJA 5CZXA 5HP1A 4DN9A 2RIJA 2V8VA 5CD4H 1VQ5S 4DL2A 2X3GA 4YB5A 4ITSA 1F60B 3OJUA 4DL7A 4CI0B 2ERRA 5IWAF 2DRAA 3UWTA 2KZMA 3CB4A 3HHEA 4DBQA 2DNGA 1K73T 4IOCQ 4IG0A 4PQUB 3OLBA 3QJPA 4URGA 3GV8B 4TKTA 4UY85 1DHMA 3NBPA 4ZKAA 4U6PA 2GJIA 2EFGA 3RR8A 1HNIB 5HMXA 2HYIB 1AUDA 2KO1A 4C3MA 4F4WA 1SBRA 3NCPA 1P27B 4KIAA 2R2TA 2KFNA 2IA6A 2OPRB 1REVB 4ZP7A 1JLEB 4ED1A 2EFQA 2HQ3A 2U1AA 1CQMA 1IUJA 4YP3A 3MOZA 4NPOA 5A0YA 4DL0C 2XY6A 3LP2B 3JAMY 2OTJS 1WG4A 2ZVSA 1YWXA 3V2UC 3PW7A 4DMZA 3CT9A 4O3PA 4BHQA 2FC8A 3ITHB 3IR7B 2DGQA 2OPSA 3OUYB 1VFJA 3FEYB 4L6V3 3DOLB 2FJWA 4Q8FA 1KLMB 1U1OA 1KFSA 2Q66A 2J0WA 3MZIA 1G1XA 2IAJB 3IA0A 5KFZA 4X4OA 3W2VB 1RISA 1S1XA 1LXNA 3C6TA 3HPOA 4K4WA 3K59A 3O2IA 2E9TA 2AV5A 3I56S 4TQSA 4QIEA 3SDEA 3DRYA 4WZQA 1ZM4A 3G8SA 2I2YA 1QSLA 2DGVA 4FBUA 1R8PA 2GIQA 3B82A 3SXLA 4TNOA 1YTYA 3ZZZA 4A48A 1WHYA 4ZCIA 4KHPF 3PNIA 4C8LA 1UJ4A 3T3FA 4HLBA 3GILA 1FK9A 5DQGA 3HZEA 2DNPA 3DI6A 5GAEI 4HVZA 5KFMA 2EKYA 3EUNA 2CQCA 5KOWA 4Y65A 2D41A 2DNKA 2OO4A 2WBRA 4OI6A 2YKAA 3IWXA 1FRHA 4NCBA 2CPXA 3IXQA 5IS2A 4K4YA 3ENWA 4I2QA 3GMGA 1DJ0A 4F02A 4YHHF 5L1KA 2IJFA 2KG0A 1G3OA 4IH5A 1TQLA 2AGQA 2K7JA 3R5DA 3CMAS 5B08A 1NJXA 2VASA 5KG1A 5ITHA 4EFAC 2NREA 3FFIB 2NPFA 3BO3A 5BYRA 4JI3F 1HNZF 1LFPA 3T5LA 4X64F 2ZE2B 2RKIA 2JH3A 2WK4A 3P96A 1KTVA 3Q0AA 2HGLA 5H1SV 3T9ZA 1S10A 4HEA9 2ABYA 3J7A1 3CXCR 2V0NA 3TAQA 4D3GA 3HXMA 4N8NA 2NSCA 4OI3A 1DAXA 1I1GA 2EFPA 2RQCA 2SXLA 4NLVA 2FVQA 3G4SS 4F4YA 1HBNB 3KG4A 1FTCA 1SI9A 4Z37A 3AJ1A 4FVCA 2ZBIA 4X65F 1FD8A 3HK2A 1EETA 3JSRA 2RVJA 4A8KA 1TK0A 1N33F 3VTIA 3VF0B 4YR0A 5G0RA 3MMAA 1S1VB 3CMES 1HI0P 3OL6A 3QLHB 4CNYA 2J9DA 3BR9A 1DTTA 2IVYA 3FMWA 3A1YG 2A2DA 1M5VC 2J0SD 3TUJC 3GE9A 4H4OB 3BSAA 3RB6A 3N9UC 4ZCMA 1KFDA 2MSTA 1OQ6A 4V19J 5E3PA 4OJGA 1M90T 1FCAA 2Y1IA 2D74B 3U27A 1RT4B 3I0RA 2DO0A 2MYFA 3PFEA 4QWBA 3M8SA 3PO5A 4DSJA 4IUFA 3KMQA 4WJBA 1K0VA 1NJYA 2MZTA 4PUOA 2ZOMA 3QO9A 4TU8A 2C3PA 2FVRA 1F5CA 1N6QA 4QIVA 4UQTA 3C8YA 1B0VA 2ZC3A 2XLKA 3BEGB 1U1RA 4KJIA 1ZETA 3DDKA 5C25B 1J5OA 1QSYA 1N0VC 1TFYA 4WE1A 1RWUA 5DG7A 5J2PB 3H5UA 1VQ6S 3ULHA 2XI2A 2QA1A 2IVMA 1KQSR 4ZVFA 2D9OA 1MU2B 4WK1A 5C42A 4LMZA 5C24B 2ZOGA 2WONB 2QEXS 1KQGB 2R7VA 4X4VA 1LW0B 2VD3A <