6GSTA

First-sphere and second-sphere electrostatic effects in the active site of a class mu glutathione transferase
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
217
structure length
217
Chain Sequence
PMILGYWNVRGLTHPIRLLLEYTDSSYEEKRYAMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGSRKITQSNAIMRYLARKHHLCGETEEERIRADIVENQVMDNRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYHIFEPKCLDAFPNLKDFLARFEGLKKISAYMKSSRYLSTPIFSKLAQWSNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MU CLASS GLUTATHIONE S-TRANSFERASE OF ISOENZYME 3-3
publication title First-sphere and second-sphere electrostatic effects in the active site of a class mu gluthathione transferase.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Transferase
total genus 79
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 1996-01-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 6gstA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 6gstA01
1LU4A 3FKFA 4ZL9A 4MF6A 4K6XA 2L6CA 4OFNA 3DGQA 1EEJA 4OWYA 2CV4A 3EWLA 4ID0A 4XRAA 3RAZA 3ZL5A 2CX3A 1UVZA 1SU9A 2P5RA 1SJIA 3TKSA 3H8QA 1USBA 3EURA 4TXOB 1HNBA 3IPZA 4HZ2A 3RPPA 2H1GA 5AN1A 1PX6A 1T8EB 3HHVA 4JEDA 3VFIA 4X43A 3BCKA 2NBSA 3APQA 4N30A 1F2EA 1GP1A 4YQUA 3FZAA 2O7KA 3ZFBA 1JZWA 4EUYA 1ZMAA 3IK7A 4K7OA 3UEMA 1BQ7A 4AGSA 4L5LA 4G0LA 3L78A 2C8UA 2DIZA 1F37A 1ZGNA 1EP8A 1O73A 1ST9A 1Z9HA 1VF3A 3EE2A 2MBTA 3IC4A 10GSA 1TOFA 4L8EA 4NHWA 4BVXA 2EIRA 3GHAA 4GQCA 2OJLA 5DALB 1MDIA 8GSSA 3QPMA 1OC3A 3F63A 4EE0A 3PPUA 4BPYA 4ECCA 1SKRB 4FIWA 3HJOA 4O5RA 2N5FA 5CRGA 2LSTA 1EZKA 1Q98A 1IYHA 2GT5A 1FW1A 3G7JA 2A2SA 3LGCA 4L5OA 2EC4A 1FOVA 1G6YA 1OE8A 3EC3A 2R4VA 3GNJA 2R3XA 2O85A 2HRKA 3VLNA 2WJUA 1R4WA 4MJEA 3O6TA 2H30A 2GGTA 13GSA 2G0FA 1B4QA 5CRWA 2XBQA 1SK2A 2YJ7A 5D8IA 1OYJA 4HU9A 4V1Ag 1TW9A 2HFDA 4K1FA 2FWGA 4MMMA 1E6BA 3TJGA 4PXOA 5IMDA 2CVBA 4MDCA 1PD21 2H72A 2REMA 1A2MA 1JZDA 2KUCA 3EU3A 2ON5A 3UAPA 2FY6A 2FGXA 1M0UA 2F8AA 1VRSD 2V41A 4MABA 3QR6A 3LWAA 3HJPA 1PA3A 1V9WA 4MZWA 4ZBAA 1NHOA 1BJXA 5A4WA 1BYEA 2VD0A 1AAZA 3FR6A 3BCIA 3F9UA 1H4OA 2CZ2A 2YJHA 1AC1A 1XWGA 2VCWA 4G0KA 1W4VA 1SK0A 3BOAA 4POMA 1XIYA 1MD3A 3APOA 3WYWA 5J41A 2O87A 1XXUA 3TB2A 3LSZA 2AJQB 2FWHA 2ES7A 1X9SB 1ON4A 1K0AA 2MMNA 1GSQA 4PNFA 4ZBDA 1GSFA 3DVWA 3UOMA 4IW9A 2VAFA 3UIWA 3HVXA 2FA8A 2XBIA 2PWJA 3CRTA 2HSHA 5D9TA 1Z7RA 2ZUPA 1TK8B 5ECSA 2YNXA 3L9SA 4KSOA 1EOHA 3EMXA 1EGOA 2IMKA 3HDCA 4TR0A 2AAWA 2L6DA 1K0DA 3CTGA 6GSWA 1A24A 4I2TA 2RUEA 1Z6MA 3DYRA 2YZHA 5KN0A 2PERA 3KTLA 3TRPA 1DE2A 3CBUA 4ZXGA 1F6MC 4V1Ap 5F05A 2V6OA 3S9FA 1T4ZA 1GUKA 1AW9A 3CSJA 3TKRA 5C04A 3N5OA 3APSA 5ECQB 2C0EA 2OACA 2GQLA 3ZFLA 1TP9A 3P2AA 4GSNA 1WIKA 4TXOA 1XFLA 1U3IA 4JR6A 3GSTA 5H5QA 1TK0B 4WXTA 5INYA 3MDKA 2IJYA 1KTEA 1AQWA 1TTZA 2RM5A 2I9HA 4EXJA 2X64A 1YKAA 1M7TA 3LYPA 3P8WA 3E0UA 5DDLA 5F8BA 1Z5YE 5G30A 1AQXA 3R3EA 5B6NA 4ECBA 1OC8A 3HXSA 2NDOA 5LD0A 1A8YA 1O85A 3KZQA 2DJ1A 4DVCA 1XWKA 2OE1A 2F9SA 5D9XA 3KH7A 2HLSA 4CDOA 2ALBA 2GQKA 3TKQA 3ED3A 1M2BA 20GSA 4F03A 3ZZXA 1YF1A 3I9V2 4G2EA 5A4UA 1XW9A 3L0HA 1GWCA 2PN8A 2DJKA 1RQMA 4N0VA 5CRDA 4GSTA 4XS6A 5DALA 4PUFC 2K8SA 3VWUA 1GTBA 1YEPA 3ISOA 4E8HA 2DMLA 2M72A 4ZB8A 3V1WA 3GRXA 3ERFA 5D73A 4IHUA 3EMPA 3DWVA 2E7PA 2L4CA 2FUG2 2OA7A 1JLVA 2PU9C 3D4TA 1YEXA 5LNKe 4I97A 5GSSA 1GUMA 1XVWA 2FD3A 2LJAA 3F3QA 3KIJA 4XHMA 4HUAA 3KJYA 3I6AA 2HI7A 3US3A 4XTSA 4KDXA 4HS1A 1MDJA 2H1DA 2H71A 1ZCPA 4F9ZA 3ZITA 3D4MA 5ENUA 3A2WA 1QUWA 5GAPD 4IVFA 3RHBA 7GSSA 5BMUA 4Z7XA 1TKDB 3VPTA 3F6DA 3P90A 3GUSA 4MH2A 1GH2A 5IOWA 1SJZA 1XOAA 2HXKA 4PGTA 4ML1A 5CNWA 3A2XA 1MEKA 1ZOFA 3IV4A 1YZXA 3UVTA 2PUKC 4IJ3A 2N5AA 1QXHA 3KD0A 4LLRA 5D9WA 5DCHA 3RDWA 1GTUA 2JSYA 3QD9A 4TXVA 3MAKA 2H0IA 1FB6A 4DSRA 1PN9A 1SD9A 1PKZA 3W8SA 1MD4A 1VF4A 3ZMKA 5DVBA 5H5RA 3TJKA 5HR3A 2VCVA 1HQOA 2G2QA 5KN2A 4ZL7A 4N10A 4AJ8A 4EDYA 1XPVA 4GWRA 2RLIA 1PRXA 3UARA 5G31A 2HRFA 2V32A 3G7IA 2WRTA 3M1GA 1ZYEA 1GSDA 1WMJA 5F0GA 4MH3A 1PSQA 3TDGA 14GSA 1F9MA 2P0GA 1S3CA 2GZYA 2DBCA 4BA7A 2FNOA 1SL1B 1GSEA 1X5DA 2HRAA 2LQQA 4PTSA 4JE1A 4GXZA 2FHEA 2KLXA 4Q5NA 3LG6A 2IMFA 1SKWB 1TRSA 1SYRA 4TR3A 2VLVA 2E0QA 4K7NA 1EV9A 4K9ZA 3VK9A 1R5AA 3Q6OA 4JBBA 3VI5A 3BJ5A 1HNCA 5L71A 5B7CA 2OKAA 2C1YA 3PR8A 3KMNA 1X9WB 2CAQA 3ME8A 12GSA 3EVIA 1N2AA 4Q5RA 4K0NA 3SWLA 5GAND 3IR4A 4HQSA 3F6FA 3F8UA 5ELGA 1EWXA 3CSHA 1U3AA 2NVLA 3TKSE 3I69A 2WULA 5AISA 4N11A 2VL3A 4OO4A 3ERGA 2OBKA 5HR2A 2YWMA 4OFMA 4K2DA 2WDUA 1H75A 2B1LA 4AJ6A 2FWEA 3GKNA 1XZOA 2YWOA 2O89A 5B8BA 2GDRA 2L5LA 2VCTA 2MMOA 3F0IA 3VURA 3M9JA 2RUFA 1XW6A 2H66A 4LA1A 2YWNA 4IP6A 2MMZA 3F3RA 2LRCA 2YANA 2HSMB 1X0RA 3HZ8A 4ILFA 3GL5A 11GSA 3C1SA 3E3EA 3GX0A 2H74A 4MPFA 4XS4B 1S3DA 2GS3A 4PNGA 2TRCP 5AGYA 4ZILA 2DC5A 2FCHA 1K0CA 3ZRDA 1K3YA 1K3OA 2DJ2A 3IXRA 4MK3A 3OR5A 3HZ4A 3DD3A 2WGRA 3PGTA 2LV3A 1EV4A 5ID2B 2GVPA 4IKHA 2AV4A 2HYXA 2CVDA 4IGJA 4EKZA 5B8AA 4BWSA 5ECLB 6GSVA 2C0FA 3HJMA 2OADA 4TRXA 1U87A 4TOPA 1QQ2A 2YWIA 4ZB9A 2LEGA 1HD2A 4L0WA 3N9JA 3W8JA 3F4SA 2BTOT 2JL4A 5HQPA 2MYGA 3IHQA 3AY8A 4HJ2A 1VF2A 4E8EA 2LS5A 3F4TA 3CSIA 2KHPA 1HNAA 4YQMA 2H70A 3QOUA 1GNEA 2H75A 1Y6EA 3TJFA 4MA9A 1M9AA 4N0ZA 1J08A 4O92A 2R6KA 4PQ1A 2VLUA 3C8EA 3HVSA 5F06A 2K6VA 3LXZA 2DSAA 4TW5A 2L4QA 1YY7A 5CO3A 4KF9A 3RPNA 3DKSA 3WGDA 3ZIJA 1TK5B 1V98A 3KEBA 3SBCA 3HD5A 1ACVA 3C73A 4DSQA 3A5WA 5ECOB 2B6MA 3TGZA 1CQHA 3CTFA 3D6IA 1KBNA 2A2RA 3FZ4A 4IJIA 3IK9A 4JZQA 3IOSA 1I9DA 3KCMA 2XPDA 5GSTA 1T1VA 3A3TA 4ZIJA 5J9BA 2YP6A 2CAIA 2K9FA 5HFGA 4MJAA 3DEXA 2L5OA 3TOUA 1R5PA 2O8VB 4MZBA 4EDZA 5JCUA 1AUCA 3GSSA 2X8HA 2TIRA 3FW2A 1E2YA 2IL3A 4GTUA 4JR4A 3TCOA 2NPBA 3D0ZA 1WJKA 1B4PA 1TU7A 2C3NA 5FT3A 3LYKA 1FB0A 2H76A 3ZTLA 5IM9A 5GZZB 4V2MA 1OAZA 4TN8A 2C3QA 1TXXA 2LQOA 2PPTA 4ZL8A 2KP1A 3LORA 3CRUA 1Z3EA 4ISDA 3EINA 5ECMB 2EIOA 3K8NA 5J4UA 2P5QA 3M3MA 4BL7B 1PGTA 5IPGA 5A4VA 6GSYA 1TJDA 1TDIA 4Q5QA 5DQYA 3ZYWA 2QKEA 4LL4B 3DIEA 4DEJA 1M9BA 3KMOA 2WCIA 4F0BA 1GLQA 4WBJA 5IIZA 1EGRA 5JCGA 3UJ1A 2VUPA 2LRNA 2HSMA 3TRXA 5CREA 2AYTA 3MWHA 2LNSA 2IWTA 1PL2A 2CT6A 4I5QA 4IP1A 1YJ6A 2LKUA 1G7EA 4WEYA 2YCDA 1K0OA 2JSZA 4XS4A 1Z6NA 5IQYA 4I8BA 5IO0A 1THXA 5HR0A 1XWAA 2PBJA 3TOTA 1GUHA 1FVJA 1VGLA 4IN0A 1SL2B 3G9BA 2B1KA 4OCEA 3HKRA 1V2AA 5ID2A 2GT6A 1KNGA 5DJMA 1GL8A 5IMZA 3TKPA 2VL9A 4HU7A 1NSWA 3D22A 4POBA 2YV7A 3U5RE 1AQVA 4KH7A 1SENA 2VOCA 1ERWA 5C00A 3C7MA 2GTUA 3ZVJD 2F3MA 2BJXA 4K7IA 4V2LA 2E2GA 4KGIA 2LJKA 4PURA 3GFKA 2IMDA 2M46A 5AIXA 2B5YA 4WBRD 4ULXA 18GSA 2QSIA 1AXDA 9GSSA 3GURA 1QGVA 5DCGA 3WGXA 3HY2A 2V6KA 3U6VA 4FYCA 1A0FA 2C3TA 2IMIA 2JU5A 1OKDA 1V40A 5ECIB 3PH9A 1W89A 4IQ1A 4YQVA 3M0FA 5EVOA 4KDUA 6GSUA 3TJJA 4WR5A 4GRFA 2DLXA 1J0FA 5ECHB 2FLSA 5KEJA 3NIVA 2JZTA 1GTAA 2B5EA 1BAYA 5J5NA 3Q19A 2VL2C 2R37A 3DXBA 4RUVA 3FHKA 1KEBA 3CMIA 4EL1A 4LMVA 2K8VA 1RW1A 2K18A 4BWQA 1OKTA 3TRQA 4QL9A 1WP0A 1GLPA 3IAS2 4K0GA 5J3RA 4RQRA 5DAKB 3GH9A 3GN3A 4XCSA 4O7HA 4IQAA 4G0IA 2OE3A 3EYTA 4X0XA 2GZPA 4IELA 1TI1A 1WPIA 4V2NA 5G2ZA 3QAVA 5G5EA 1O8WA 4AF2A 1LJRA 5HFIA 5G5FA 2VCZA 1DUGA 4IS0A 1O6JA 5A5KA 5IMCA 2DJJA 4DSSB 2PMTA 4POKA 5KN3A 4USSA 1ERUA 1T3BA 3IC8A 2HZEB 3QAGA 3FY7A 1GTIA 4MCUA 3IA1A 2YOIA 2H6XA 1WWJA 4PUAA 22GSA 3O3TA 2OBIA 2V1MA 4EF0A 1JFUA 4WF5A 4JRRA 3L9UA 6GSSA 4F82A 5FHIA 4H86A 2GLRA 2QGVA 4JU5A 4F2IA 4AJ7A 2DJ0A 4BL7A 2IPAA 1PQNA 4ECIA 4XS1A 1ILOA 1TRUA 6GSXA 5D93A 3GKXA 2VO4A 5CP1A 3WT1A 2HZFA 4D73B 1JHBA 2Z9SA 1F3AA 1ZL9A 3GKMA 1R7HA 2XC2A 1GSSA 5HFKA 3GV1A 4KB3A 2C4JA 1G0TA 4NAXA 5ECRB 1NW2A 3ME7A 4PQHA 2H1BA 2V2GA 2VIMA 3QDNA 4RQXA 3GTUB 5DQSA 4G9HA 4I2UA 1HYUA 1JZOA 2YN1A 4HJMA 2H1AA 4J57E 3NOFA 2UZ8A 2F8FA 2KP2A 2FA4A 1GNWA 3I43A 2LRTA 3HVVA 5CAXA 2LJRA 1N8JA 3E9JB 3O76A 4MJBA 2HRNA 2M80A 2AHEA 2JZSA 4HQZA 5AIVA 1XVQA 5B6MA 3LJRA 3FYGA 4WR4A 4MF5A 1DE1A 4YAPA 2HSYA 5G1KA 5ECKB 3PINA 6GSTA 2YV9A 2EIQA 1PX7A 1EEMA 2GZZA 1JLWA 5JWOB 2I81A 4BVYB 1MTCA 2LTKA 3QMXA 1URMA 5FWGA 2J9HA 2C0GA 1T4YA 2VCXA 2H19A 1A8LA 5IMAA 1K3LA 3FRCA 1UN2A 2WFCA 1OE7A 1XWBA 2H6ZA 2HSNB 2DIYA 3MNGA 5IMFA 5HR1A 1OC9B 2J23A 4YH2A 3QFAC 4KA0A 2GSSA 1OVNA 4HZ4A 1XCCA 3QAWA 3UVHA 3TJBA 3P7XA 2RIIA 1XW5A 3VWXA 5D9VA 4IBPA 3J7Yb 1X5CA 3UBKA 1O81A 4EO3A 3IRAA 4NPBA 2YPMA 2CA8A 3GX8A 1K0MA 1R26A 3JCML 4MJCA 2VL2A 3VPQA 1C72A 1B8XA 2PGTA 1IYIA 3H1NA 3KP9A 5DAKA 2ZNMA 1CQGA 5IMVA 3IAM2 1U6TA 1UC7A 2MBSA 5D96A 2R5GA 4POLA 3IE3A 3GL3A 1FHEA 4KX4A 3LXTA 2GQMA 5COHA 3WD6A 4CHSA 2D2ZA 4NMUA 3WGEA 2IN3A 2B3SA 4F0CA 2VD1A 1GULA 5E59A 1SJ6A 4OO5A 3C1RA 2HNLA 4NV2A 2H0GA 3FK8A 4DSSA 1SYXA 2L57A 4HOJA 2VLTA 1PL1A 1LBKA 1XOBA 4TKYA 3GKKA 2HZEA 4TR1B 5ELAA 1SKSB 2XHFA 3IDVA 4WF4A 1V57A 4RI6A 3KXOA 2X99A 1T00A 3H79A 1MDKA 5CRHA 2MZCA 2E2MA 2H6YA 4HDEA 2BMXA 4X1UA 1ERVA 1K0NA 2NTOA 3CYNA 5CYYA 2KOKA 3Q18A 1ZZYA 4EC0A 5IOXA 3L9VA 4KAEA 4LL1B 4D73A 1GSUA 4KE3A 5JCWA 1F3BA 1AIUA 5IO2A 2GSRA 2IMEA 1EP7A 2WS2A 4LMWA 3GMFA 2F51A 3R2QA 2GSTA 2XPEA 4G10A 2B5XA 1J9BA 3H4KA 1ZYQB 4ECJA 3RBTA 5IPHA 2GSQA 2IFQB 3MSZA 3GTUA 3ZREA 1SL0B 1I5GA 5ECPB 4GLTA 2X8GA 4P3YB 2H8LA 1A2JA 4KDYA 2B7JA 3LEFA 17GSA 1JZRA 2ZCTA 2YZUA 3J7Yk 4FYBA 2H73A 2HT9A 4J2FA 3L4NA 1B9XC 3CXGA 2FWFA 1VF1A 1B9YC 4K8MA 4GF0A 3FEUA 4MF7A 3QCPA 4YAVA 3RHCA 2DJ3A 2HE3A 2C0DA 1K0BA 4QL7A 3KP8A 1G7OA 1XWCA 1YKCA 1SD8A 4BVYA 2CX4A 2RM6A 5JWRB 1THOA 4OMVA 1X5EA 2QC7A 4I6XA 2CQ9A 16GSA 2AUVA 2LUSA 1M2DA 3TKSC 4ACSA 4ZBBA 3GA4A 4NXIA 4GQFA 1PKWA 1FVKA 3LFLA 3DMLA 1QMVA 1TRWA 5G1LA 1S3AA 3KH9A 1TI3A 2VM2A 3ZMLA 1OC9A 1A23A 3G7YA 4L0UA 3D21A 4GSSA 1NHYA 1TU8A 4FYUA 3HYPA 2VM1A 5JWQB 3WT2A 3FR9A 4NV5A 1M2AA 3EU4A 1PMTA 2JADA 3UMAA 4KNDA 1Q4JA 3M9KA 1U88A 4ZB6A 2L59A 3TUEA 3F4RA 3UBLA 3NZNA 3DVXA 1ERTA 4GCIA 1EOGA 1BX9A 5DBQA 3M8NA 2VCQA 1NM3A 3ERWA 1V58A 2IIYA 3ZLPA 5F07A 4WKWA 1WOUA 3IBHA 5ECNB 4OFTA 4OCFA 3W6GA 2I1UA 1FAAA 2DMMA 5H5SA 4BVXB 3VWVA 2B7KA 4KW6A 4TVEA 3GYKA 3DRNA 4CW9A 5ABRA 4WETA 1O8XA 2H0HA 2LNTA 2TRXA 2H01A 3KTBA 3UL3A 1DBYA 1TRVA 1FO5A 1GRXA 4ML6A 3LQ7A 5LCZA 1UA5A 3ZIVA 2AB6A 1RK4A 4PQIA 1GSYA 2JZRA 2HRKB 3VI7A 5EY6A 2CZ3A 3D5JA 4TR1A 3ZVJA 3BD2A 1B48A 2OE0A 4TR4A 4KCAA 1ML6A 4O32A 4Q5FA 5KN1A 2A4VA 3FZ9A 4HI7A 3KM6A 1T7PB 3HCZA 4EVMA 1SK1A 4MZCA 2C80A 4QQ7A 4NWYA 1M99A 2I4AA 4FQUA 3BBYA 19GSA 4FH8A 5DJLA 4J56E 2X8CA 1A0RP 3VWWA 3HA9A 4XIHA 3H93A 4KUNA 1A2LA 4OD7A 1Y25A 4KSMA 1BEDA 1Z7PA 2JACA 1WE0A 1YF0A 2R2JA 4KCEA 1O7UA 2I3YA 2IFQA 4RI7A 2WZ9A 1QFNA 5E4WA 4MP4A 1X9MB 2PVQA 4HEA2 2HQTA 2CVKA 2P31A 1QK8A 3GH6A 1YDKA 3FR3A 2MMAA 2WB9A 5J9CA 3Q74A 1BG5A 2ON7A 4XRDA 3C71A 1DSBA 4MLYA 1G6WA 3A2VA 3QFBC 4NHZA 1ABAA 1YQ1A 4FO5A 4PX1A 5EL8A 1FG4A 3KGKA 4MPGA 3GIXA 1XBSA 4G19A 5EPFA 2N5BA 2PVOC 3FZ5A 1WRYA
chains in the Genus database with same CATH superfamily
1LU4A 3FKFA 4ZL9A 4MF6A 4K6XA 2L6CA 4OFNA 3DGQA 1EEJA 4OWYA 2CV4A 3EWLA 4ID0A 4XRAA 3RAZA 3ZL5A 2CX3A 1UVZA 1SU9A 2P5RA 1SJIA 3TKSA 3H8QA 1USBA 3EURA 4TXOB 1HNBA 3IPZA 4HZ2A 3RPPA 2H1GA 5AN1A 1PX6A 1T8EB 4QMKA 2WVXA 3HHVA 4JEDA 3VFIA 4X43A 3BCKA 2NBSA 3APQA 4N30A 1F2EA 1GP1A 4YQUA 3FZAA 2O7KA 3ZFBA 1JZWA 4EUYA 1ZMAA 3IK7A 4K7OA 3UEMA 1BQ7A 4AGSA 4L5LA 4G0LA 3L78A 5A34A 2C8UA 2DIZA 4BIKA 1F37A 1ZGNA 1EP8A 1O73A 1ST9A 2A2PA 1Z9HA 1VF3A 3EE2A 2MBTA 3IC4A 10GSA 1TOFA 4L8EA 4NHWA 4BVXA 2EIRA 5J4VA 3GHAA 4GQCA 2OJLA 5DALB 1MDIA 8GSSA 3QPMA 1OC3A 3F63A 4EE0A 3PPUA 4BPYA 4ECCA 1SKRB 4FIWA 3HJOA 4O5RA 2N5FA 5CRGA 2LSTA 1EZKA 1Q98A 1IYHA 2GT5A 1FW1A 3G7JA 2A2SA 3LGCA 4L5OA 2EC4A 1FOVA 1G6YA 1OE8A 3EC3A 2R4VA 3GNJA 4EIQA 2R3XA 2O85A 2HRKA 3VLNA 2WJUA 1R4WA 4MJEA 3O6TA 2H30A 5J4YA 2GGTA 13GSA 2G0FA 1B4QA 5CRWA 2XBQA 1SK2A 2YJ7A 5D8IA 1OYJA 4HU9A 4V1Ag 1TW9A 2HFDA 4K1FA 2FWGA 4MMMA 1E6BA 3TJGA 4PXOA 5IMDA 2CVBA 4MDCA 1PD21 2H72A 2REMA 1A2MA 1JZDA 2KUCA 3EU3A 2ON5A 3UAPA 2FY6A 2O36A 2VKZG 2FGXA 1M0UA 2F8AA 1VRSD 2V41A 4MABA 3QR6A 3LWAA 3HJPA 1PA3A 1V9WA 4MZWA 5BMUB 4ZBAA 1NHOA 1BJXA 5A4WA 1BYEA 2VD0A 1AAZA 3FR6A 3BCIA 3F9UA 1H4OA 2CZ2A 2YJHA 1AC1A 1XWGA 2VCWA 4G0KA 1W4VA 1SK0A 3BOAA 4POMA 1XIYA 1MD3A 3APOA 3WYWA 5J41A 2O87A 3EPTA 1XXUA 3TB2A 3LSZA 2AJQB 2FWHA 2ES7A 1X9SB 1ON4A 1K0AA 2MMNA 1GSQA 4PNFA 4ZBDA 1GSFA 4FXYP 3DVWA 3UOMA 4IW9A 2VAFA 3UIWA 3HVXA 2FA8A 2XBIA 2PWJA 3CRTA 2HSHA 5D9TA 1Z7RA 2ZUPA 1TK8B 5ECSA 2YNXA 3L9SA 2QA1A 4KSOA 1EOHA 3EMXA 1EGOA 2IMKA 3HDCA 4TR0A 2AAWA 2L6DA 1K0DA 3CTGA 6GSWA 1A24A 4I2TA 2RUEA 1Z6MA 4MNNA 3DYRA 2YZHA 3RFRC 2EFDA 2PERA 3KTLA 5KN0A 3TRPA 1DE2A 3CBUA 4ZXGA 1F6MC 4V1Ap 5F05A 2V6OA 3S9FA 1T4ZA 1GUKA 1AW9A 3CSJA 3TKRA 5C04A 3N5OA 3RGBC 3APSA 5ECQB 2C0EA 2OACA 2GQLA 3ZFLA 1TP9A 3P2AA 4GSNA 1WIKA 4TXOA 1XFLA 1U3IA 4JR6A 3GSTA 5H5QA 1TK0B 4WXTA 5INYA 3MDKA 2IJYA 1KTEA 1AQWA 1TTZA 2RM5A 2I9HA 4EXJA 2X64A 1YKAA 1M7TA 3LYPA 3P8WA 3E0UA 5DDLA 5F8BA 1Z5YE 5G30A 1AQXA 3R3EA 5B6NA 4ECBA 1OC8A 3HXSA 2NDOA 5LD0A 1A8YA 1O85A 3KZQA 2DJ1A 4DVCA 1XWKA 2OE1A 2F9SA 5D9XA 3KH7A 2HLSA 4CDOA 2ALBA 2GQKA 3TKQA 3ED3A 1M2BA 1M3IA 20GSA 4F03A 3ZZXA 1YF1A 3I9V2 4G2EA 4HSCX 5A4UA 1XW9A 3L0HA 1GWCA 2PN8A 2DJKA 1RQMA 4N0VA 5CRDA 4GSTA 4XS6A 5DALA 4PUFC 2K8SA 3VWUA 2EFEA 1GTBA 1YEPA 3ISOA 4E8HA 2DMLA 2M72A 4ZB8A 3V1WA 3GRXA 3ERFA 5D73A 4IHUA 3EMPA 3DWVA 4K5SA 2E7PA 2L4CA 2FUG2 2OA7A 1JLVA 2PU9C 3D4TA 1YEXA 5KOXA 5LNKe 4I97A 5GSSA 1GUMA 1XVWA 2FD3A 2LJAA 3F3QA 3KIJA 4XHMA 4HUAA 3KJYA 4ICYA 3I6AA 2HI7A 4GDFA 4CY8A 3US3A 4XTSA 4KDXA 4HS1A 1MDJA 2H1DA 2H71A 1ZCPA 4F9ZA 3ZITA 2WZSA 3D4MA 5ENUA 3A2WA 1QUWA 5GAPD 3CHXC 4IVFA 3RHBA 7GSSA 5BMUA 4Z7XA 1TKDB 4O5QA 3VPTA 3F6DA 3P90A 1Y1UA 3GUSA 1GH2A 4MH2A 5IOWA 4AKIA 1SJZA 1XOAA 2HXKA 4PGTA 4ML1A 4O5UA 5CNWA 3A2XA 1MEKA 1ZOFA 3IV4A 1YZXA 3UVTA 2PUKC 4IJ3A 2N5AA 1QXHA 3KD0A 4LLRA 5D9WA 5DCHA 3RDWA 1GTUA 2JSYA 3QD9A 4TXVA 3MAKA 2H0IA 1FB6A 4DSRA 1PN9A 1SD9A 1PKZA 2X4AA 3W8SA 1MD4A 1VF4A 3ZMKA 5DVBA 5H5RA 3TJKA 5HR3A 2VCVA 1HQOA 2G2QA 5KN2A 4ZL7A 4N10A 4AJ8A 4EDYA 1XPVA 4GWRA 2RLIA 1PRXA 3UARA 5G31A 2HRFA 2V32A 3G7IA 2WRTA 3M1GA 1ZYEA 1GSDA 1WMJA 5F0GA 4MH3A 1PSQA 4PI0C 3TDGA 14GSA 1F9MA 2P0GA 1S3CA 2GZYA 2DBCA 4BA7A 2FNOA 1SL1B 1GSEA 1X5DA 2HRAA 2LQQA 4PTSA 4JE1A 4GXZA 2FHEA 2KLXA 4Q5NA 3LG6A 2IMFA 1SKWB 1TRSA 1SYRA 4TR3A 2VLVA 2E0QA 4K7NA 1EV9A 4K9ZA 3VK9A 1R5AA 3Q6OA 4JBBA 3VI5A 3BJ5A 1HNCA 5L71A 1BF5A 5B7CA 2OKAA 2R0GA 2C1YA 3PR8A 3KMNA 1X9WB 2CAQA 3ME8A 12GSA 3EVIA 1N2AA 4Q5RA 4K0NA 3SWLA 5GAND 3IR4A 4HQSA 3F6FA 3F8UA 4ZB7A 5ELGA 1EWXA 3CSHA 1U3AA 2NVLA 3TKSE 3I69A 2WULA 5AISA 4N11A 2VL3A 4OO4A 3ERGA 2OBKA 5HR2A 2YWMA 4OFMA 4K2DA 2WDUA 1H75A 2B1LA 4AJ6A 2FWEA 3GKNA 1XZOA 2YWOA 2O89A 5B8BA 2GDRA 2L5LA 2VCTA 2MMOA 3F0IA 3VURA 3M9JA 2RUFA 3HMJG 1XW6A 2H66A 4LA1A 2YWNA 4IP6A 2MMZA 3F3RA 2LRCA 2YANA 2HSMB 1X0RA 3HZ8A 4ILFA 3GL5A 11GSA 3C1SA 3E3EA 3GX0A 2H74A 4A5PA 4MPFA 4XS4B 1S3DA 2GS3A 4PNGA 2TRCP 5AGYA 4ZILA 2DC5A 2FCHA 1K0CA 3ZRDA 1K3YA 1K3OA 2DJ2A 3IXRA 4MK3A 3OR5A 3HZ4A 3DD3A 2WGRA 3PGTA 2LV3A 1EV4A 2UV8G 5ID2B 2GVPA 4IKHA 2AV4A 2HYXA 2CVDA 1FOHA 4Z2UA 4IGJA 4EKZA 5B8AA 4BWSA 5ECLB 6GSVA 2C0FA 3MIXA 1I1IP 3HJMA 2OADA 4TRXA 1U87A 4TOPA 1QQ2A 2YWIA 4ZB9A 2LEGA 1HD2A 4L0WA 3N9JA 3W8JA 3F4SA 2BTOT 2JL4A 5HQPA 2MYGA 1PN0A 3IHQA 3AY8A 4HJ2A 1VF2A 4E8EA 2LS5A 3F4TA 3CSIA 2KHPA 1HNAA 4YQMA 2H70A 3QOUA 1GNEA 2H75A 1Y6EA 3TJFA 4MA9A 1M9AA 4N0ZA 1J08A 4O92A 1SVLA 2R6KA 4PQ1A 2VLUA 3C8EA 3HVSA 5F06A 5J47A 2K6VA 3LXZA 2DSAA 4TW5A 2L4QA 2WVZA 1YY7A 5CO3A 4KF9A 3RPNA 3DKSA 3WGDA 3ZIJA 1TK5B 1V98A 3KEBA 3SBCA 3HD5A 1ACVA 3C73A 4DSQA 3A5WA 3LW9A 5ECOB 4YKGA 2B6MA 3TGZA 1CQHA 3CTFA 3D6IA 1KBNA 1YEWC 2H1LA 2A2RA 3FZ4A 4IJIA 3IK9A 4JZQA 3IOSA 1I9DA 3KCMA 2XPDA 5GSTA 1T1VA 3A3TA 4ZIJA 5J9BA 2YP6A 2CAIA 2EFCA 2X49A 2K9FA 5HFGA 1BG1A 4MJAA 4YKFA 3DEXA 2L5OA 3TOUA 1R5PA 1N25A 2O8VB 4MZBA 4EDZA 5JCUA 1AUCA 3GSSA 2X8HA 1SVMA 4E68A 2TIRA 3FW2A 1E2YA 2IL3A 4GTUA 4JR4A 3TCOA 2NPBA 3D0ZA 1WJKA 1B4PA 1TU7A 2C3NA 5FT3A 3LYKA 1FB0A 2H76A 3ZTLA 5IM9A 5GZZB 4V2MA 1OAZA 4TN8A 2C3QA 1TXXA 2LQOA 2PPTA 4ZL8A 5A5HB 2KP1A 3LORA 3CRUA 1Z3EA 4ISDA 3EINA 5ECMB 5J40A 2EIOA 3K8NA 5J4UA 2P5QA 3M3MA 4BL7B 1PGTA 5IPGA 5A4VA 6GSYA 1TJDA 3CWGA 1TDIA 4Q5QA 5DQYA 3ZYWA 2QKEA 4LL4B 3DIEA 4DEJA 1M9BA 3KMOA 2WCIA 4F0BA 1GLQA 4WBJA 5IIZA 4PI2C 1EGRA 5JCGA 3UJ1A 2VUPA 2LRNA 2HSMA 3TRXA 5CREA 2AYTA 3MWHA 2LNSA 2IWTA 4K2XA 1PL2A 2CT6A 4I5QA 4IP1A 1YJ6A 2LKUA 1G7EA 4WEYA 2YCDA 1K0OA 2JSZA 4XS4A 1Z6NA 5IQYA 4I8BA 5IO0A 1THXA 5HR0A 1XWAA 2PBJA 3TOTA 1GUHA 1FVJA 1VGLA 4N3ZA 3IHGA 4IN0A 2O3EA 1SL2B 3G9BA 2B1KA 4OCEA 3HKRA 1V2AA 5ID2A 2GT6A 1KNGA 5DJMA 1GL8A 5IMZA 3TKPA 2VL9A 4HU7A 1NSWA 3D22A 4POBA 2YV7A 3U5RE 1AQVA 4KH7A 1SENA 2VOCA 1ERWA 5C00A 3C7MA 2GTUA 3ZVJD 2F3MA 2BJXA 4K7IA 4V2LA 2E2GA 4KGIA 2LJKA 4PURA 3GFKA 2IMDA 2M46A 5AIXA 2B5YA 4WBRD 4ULXA 18GSA 2QSIA 1AXDA 9GSSA 3GURA 1QGVA 5DCGA 3WGXA 3HY2A 2V6KA 3U6VA 4FYCA 1A0FA 2C3TA 2IMIA 2JU5A 1OKDA 1V40A 5ECIB 3PH9A 1W89A 4IQ1A 4YQVA 3M0FA 5EVOA 1ZYNA 4Z2RA 4KDUA 6GSUA 3TJJA 4WR5A 4GRFA 2DLXA 1S3RA 1J0FA 5ECHB 2FLSA 5KEJA 3NIVA 2JZTA 1GTAA 4PHZC 2B5EA 1BAYA 5J5NA 3Q19A 2VL2C 2R37A 1PFOA 3DXBA 4RUVA 3FHKA 1KEBA 3CMIA 4EL1A 4LMVA 2K8VA 1RW1A 1S4BP 2K18A 4BWQA 1OKTA 3TRQA 4QL9A 1WP0A 1GLPA 3IAS2 4K0GA 5J3RA 4RQRA 5DAKB 3GH9A 3GN3A 4XCSA 4O7HA 4IQAA 4G0IA 2OE3A 3EYTA 4X0XA 2GZPA 4W66A 4IELA 1TI1A 1WPIA 4V2NA 5G2ZA 3QAVA 5G5EA 1O8WA 4AF2A 1LJRA 5HFIA 5G5FA 2VCZA 1DUGA 4IS0A 1O6JA 5A5KA 5IMCA 2DJJA 4DSSB 2PMTA 4POKA 5KN3A 4USSA 1ERUA 1T3BA 3IC8A 2HZEB 3QAGA 3FY7A 1GTIA 4MCUA 3IA1A 2YOIA 2H6XA 1WWJA 4PUAA 3FMWA 22GSA 3O3TA 2OBIA 2V1MA 4EF0A 1JFUA 4WF5A 4JRRA 3L9UA 5A5HA 6GSSA 4F82A 5FHIA 4H86A 2GLRA 4AKXB 2QGVA 4JU5A 4F2IA 4AJ7A 2DJ0A 4BL7A 2IPAA 1PQNA 4ECIA 4XS1A 1ILOA 1TRUA 6GSXA 5D93A 3GKXA 2VO4A 5CP1A 1TXUA 3WT1A 2HZFA 4D73B 1JHBA 2Z9SA 1F3AA 1ZL9A 3GKMA 1R7HA 2XC2A 2R0PA 1GSSA 5HFKA 3GV1A 4KB3A 2C4JA 1G0TA 4NAXA 5ECRB 1NW2A 3ME7A 2DKHA 4PQHA 2H1BA 2EFHA 2V2GA 2VIMA 3QDNA 4RQXA 3GTUB 5DQSA 4G9HA 4I2UA 1HYUA 1JZOA 2YN1A 4HJMA 2H1AA 4J57E 3NOFA 2UZ8A 2F8FA 2KP2A 2FA4A 1GNWA 3I43A 2LRTA 3HVVA 5CAXA 2LJRA 1N8JA 3E9JB 3O76A 4MJBA 2HRNA 2M80A 2AHEA 2JZSA 4HQZA 5AIVA 1XVQA 5B6MA 1YVLA 3LJRA 3FYGA 4WR4A 4MF5A 1DE1A 4YAPA 2HSYA 5G1KA 5ECKB 3PINA 6GSTA 2YV9A 2EIQA 1PX7A 1EEMA 2GZZA 1JLWA 5JWOB 2I81A 4BVYB 1MTCA 2LTKA 3QMXA 1URMA 5FWGA 2J9HA 2C0GA 1T4YA 2VCXA 2H19A 1A8LA 5IMAA 1K3LA 3FRCA 1UN2A 2WFCA 1OE7A 1XWBA 2H6ZA 2HSNB 3MYDA 2DIYA 3MNGA 5IMFA 5HR1A 1OC9B 2J23A 3HVNA 4YH2A 3QFAC 4KA0A 2GSSA 1OVNA 4HZ4A 1XCCA 2WVYA 3QAWA 3UVHA 3TJBA 3P7XA 2RIIA 1XW5A 4CY6A 3VWXA 5D9VA 4IBPA 3J7Yb 1X5CA 3UBKA 1O81A 4EO3A 3IRAA 4NPBA 2YPMA 2CA8A 3GX8A 1K0MA 1R26A 3A5IA 3JCML 4MJCA 2VL2A 3VPQA 1C72A 1B8XA 2PGTA 1IYIA 3H1NA 2QA2A 3KP9A 4K5RA 5DAKA 2ZNMA 1CQGA 5IMVA 3IAM2 1U6TA 1UC7A 2MBSA 5D96A 2R5GA 4POLA 3IE3A 3GL3A 2WW2A 1FHEA 4KX4A 3LXTA 2GQMA 5COHA 3WD6A 4CHSA 2D2ZA 4NMUA 3WGEA 2IN3A 2B3SA 4F0CA 2VD1A 1GULA 5E59A 1SJ6A 4OO5A 3C1RA 2HNLA 4NV2A 2H0GA 3FK8A 4DSSA 1SYXA 2L57A 2WW3A 4HOJA 2VLTA 1PL1A 1LBKA 1XOBA 4TKYA 3GKKA 2HZEA 4TR1B 5ELAA 1SKSB 2XHFA 3IDVA 4WF4A 1V57A 4RI6A 3KXOA 2X99A 1T00A 3H79A 1MDKA 5CRHA 1M3JA 2MZCA 2E2MA 5BRTA 2H6YA 4HDEA 2BMXA 4X1UA 1ERVA 1K0NA 2NTOA 3CYNA 5CYYA 2WW1A 2KOKA 3Q18A 1ZZYA 4EC0A 5IOXA 3L9VA 4KAEA 4LL1B 4D73A 1GSUA 4KE3A 5JCWA 1F3BA 1AIUA 5IO2A 2GSRA 2IMEA 1EP7A 2WS2A 4LMWA 3GMFA 2F51A 3R2QA 2GSTA 2XPEA 4G10A 2B5XA 2O5VA 1J9BA 3H4KA 1ZYQB 4ECJA 3RBTA 5IPHA 2GSQA 2IFQB 3MSZA 3GTUA 3ZREA 1SL0B 1I5GA 4AI6A 5ECPB 4GLTA 2X8GA 2A4HA 4P3YB 2H8LA 1A2JA 4KDYA 2B7JA 3LEFA 17GSA 1JZRA 2ZCTA 2YZUA 4Z2TA 3J7Yk 4FYBA 2H73A 2HT9A 4J2FA 3L4NA 1B9XC 3CXGA 2FWFA 1VF1A 1B9YC 5A1NB 4GF0A 3FEUA 4K8MA 4MF7A 3TU3B 3QCPA 4YAVA 3RHCA 2DJ3A 2HE3A 2C0DA 1K0BA 4QL7A 3KP8A 1G7OA 1XWCA 1YKCA 1SD8A 4BVYA 2CX4A 2RM6A 5JWRB 1THOA 5KOWA 4OMVA 1X5EA 2QC7A 4I6XA 2CQ9A 16GSA 2AUVA 2LUSA 1M2DA 3TKSC 4ACSA 4ZBBA 3GA4A 4NXIA 4GQFA 1PKWA 1FVKA 3LFLA 3DMLA 1QMVA 1TRWA 5G1LA 1S3AA 3KH9A 2HSNA 1TI3A 2VM2A 3ZMLA 2R0CA 1OC9A 1A23A 3G7YA 4L0UA 3D21A 4GSSA 1NHYA 4AKHA 1TU8A 4FYUA 3HYPA 2VM1A 5JWQB 3WT2A 3FR9A 2WVXB 4NV5A 1M2AA 3EU4A 1PMTA 2JADA 3UMAA 4KNDA 1Q4JA 3M9KA 1U88A 4ZB6A 2L59A 3TUEA 3F4RA 3UBLA 3NZNA 3DVXA 1ERTA 4GCIA 1EOGA 1BX9A 5DBQA 3M8NA 2VCQA 1NM3A 3ERWA 1V58A 5A34B 2IIYA 3ZLPA 5F07A 4WKWA 1WOUA 3IBHA 5ECNB 2OT3A 4OFTA 4OCFA 3W6GA 1ZYPA 2I1UA 1FAAA 2DMMA 2DKIA 4BVXB 5H5SA 3VWVA 2B7KA 4KW6A 4TVEA 3GYKA 3DRNA 4CW9A 5ABRA 4WETA 1O8XA 2H0HA 2LNTA 2TRXA 2H01A 3KTBA 3UL3A 1DBYA 1TRVA 1FO5A 1GRXA 4ML6A 3LQ7A 5LCZA 1UA5A 3ZIVA 2AB6A 1RK4A 4PQIA 1GSYA 2JZRA 2HRKB 3VI7A 5EY6A 2CZ3A 3D5JA 4TR1A 3ZVJA 1SVOA 3BD2A 1B48A 2OE0A 4TR4A 4KCAA 1ML6A 4O32A 4Q5FA 5KN1A 2A4VA 3FZ9A 4HI7A 3KM6A 1T7PB 3HCZA 4EVMA 1SK1A 4MZCA 2C80A 4QQ7A 4NWYA 4EIPA 1M99A 2I4AA 4FQUA 3BBYA 19GSA 4FH8A 5DJLA 4J56E 2X8CA 2WW0A 1A0RP 3VWWA 3CQFA 3HA9A 4XIHA 3H93A 4KUNA 1A2LA 4OD7A 1Y25A 4KSMA 1BEDA 1Z7PA 2JACA 1WE0A 1YF0A 4X4JA 2R2JA 4KCEA 1O7UA 1XG8A 2I3YA 2IFQA 4RI7A 2WZ9A 1QFNA 5E4WA 4MP4A 1X9MB 2PVQA 4HEA2 2HQTA 2CVKA 2P31A 1QK8A 3GH6A 1YDKA 3FR3A 2MMAA 2WB9A 5J9CA 3Q74A 1BG5A 2ON7A 4XRDA 3C71A 5A1NA 1DSBA 4MLYA 4AKGA 1G6WA 3A2VA 3QFBC 4NHZA 1ABAA 1YQ1A 4FO5A 4PX1A 5EL8A 1FG4A 3KGKA 4G01A 4MPGA 3GIXA 1XBSA 4G19A 5EPFA 2N5BA 2PVOC 3FZ5A 1WRYA
chains in the Genus database with same CATH topology
1LU4A 3FKFA 4ZL9A 4MF6A 4K6XA 2L6CA 4OFNA 3DGQA 1EEJA 4OWYA 2CV4A 3EWLA 4ID0A 4XRAA 3RAZA 3ZL5A 2CX3A 1UVZA 1SU9A 2P5RA 1SJIA 3TKSA 3H8QA 1USBA 3EURA 4TXOB 1HNBA 3IPZA 4HZ2A 3RPPA 2H1GA 5AN1A 1PX6A 1T8EB 4QMKA 3HHVA 4JEDA 3VFIA 4X43A 3BCKA 2NBSA 3APQA 4N30A 1F2EA 1GP1A 4YQUA 3FZAA 2O7KA 3ZFBA 1JZWA 4EUYA 1ZMAA 3IK7A 4K7OA 3UEMA 1BQ7A 4AGSA 4L5LA 4G0LA 3L78A 5A34A 2C8UA 2DIZA 1F37A 1ZGNA 1EP8A 1O73A 1ST9A 2A2PA 1Z9HA 1VF3A 3EE2A 2MBTA 3IC4A 10GSA 1TOFA 4L8EA 4NHWA 4BVXA 2EIRA 5J4VA 3GHAA 4GQCA 2OJLA 5DALB 1MDIA 8GSSA 3QPMA 1OC3A 3F63A 4EE0A 3PPUA 4BPYA 4ECCA 1SKRB 4FIWA 3HJOA 4O5RA 2N5FA 5CRGA 2LSTA 1EZKA 1Q98A 1IYHA 2GT5A 1FW1A 3G7JA 2A2SA 3LGCA 4L5OA 2EC4A 1FOVA 1G6YA 1OE8A 3EC3A 2R4VA 3GNJA 4EIQA 2R3XA 2O85A 2HRKA 3VLNA 2WJUA 1R4WA 4MJEA 3O6TA 2H30A 5J4YA 2GGTA 13GSA 2G0FA 1B4QA 5CRWA 2XBQA 1SK2A 2YJ7A 5D8IA 1OYJA 4HU9A 4V1Ag 1TW9A 2HFDA 4K1FA 2FWGA 4MMMA 1E6BA 3TJGA 4PXOA 5IMDA 2CVBA 4MDCA 1PD21 2H72A 2REMA 1A2MA 1JZDA 2KUCA 3EU3A 2ON5A 3UAPA 2FY6A 2VKZG 2FGXA 1M0UA 2F8AA 1VRSD 2V41A 4MABA 3QR6A 3LWAA 3HJPA 1PA3A 1V9WA 4MZWA 5BMUB 4ZBAA 1NHOA 1BJXA 5A4WA 1BYEA 2VD0A 1AAZA 3FR6A 3BCIA 3F9UA 1H4OA 2CZ2A 2YJHA 1AC1A 1XWGA 2VCWA 4G0KA 1W4VA 1SK0A 3BOAA 4POMA 1XIYA 1MD3A 3APOA 3WYWA 5J41A 2O87A 3EPTA 1XXUA 3TB2A 3LSZA 2AJQB 2FWHA 2ES7A 1X9SB 1ON4A 1K0AA 2MMNA 1GSQA 4PNFA 4ZBDA 1GSFA 3DVWA 3UOMA 4IW9A 2VAFA 3UIWA 3HVXA 2FA8A 2XBIA 2PWJA 3CRTA 2HSHA 5D9TA 1Z7RA 2ZUPA 1TK8B 5ECSA 2YNXA 3L9SA 2QA1A 4KSOA 1EOHA 3EMXA 1EGOA 2IMKA 3HDCA 4TR0A 2AAWA 2L6DA 1K0DA 3CTGA 6GSWA 1A24A 4I2TA 2RUEA 1Z6MA 4MNNA 3DYRA 2YZHA 5KN0A 2EFDA 2PERA 3KTLA 3TRPA 1DE2A 3CBUA 4ZXGA 1F6MC 4V1Ap 5F05A 2V6OA 3S9FA 1T4ZA 1GUKA 1AW9A 3CSJA 3TKRA 5C04A 3N5OA 3APSA 5ECQB 2C0EA 2OACA 2GQLA 3ZFLA 1TP9A 3P2AA 4GSNA 1WIKA 4TXOA 1XFLA 1U3IA 4JR6A 3GSTA 5H5QA 1TK0B 4WXTA 5INYA 3MDKA 2IJYA 1KTEA 1AQWA 1TTZA 2RM5A 2I9HA 4EXJA 2X64A 1YKAA 1M7TA 3LYPA 3P8WA 3E0UA 5DDLA 5F8BA 1Z5YE 5G30A 1AQXA 3R3EA 5B6NA 4ECBA 1OC8A 3HXSA 2NDOA 5LD0A 1A8YA 1O85A 3KZQA 2DJ1A 4DVCA 1XWKA 2OE1A 2F9SA 5D9XA 3KH7A 2HLSA 4CDOA 2ALBA 2GQKA 3TKQA 3ED3A 1M2BA 20GSA 4F03A 3ZZXA 1YF1A 3I9V2 4G2EA 5A4UA 1XW9A 3L0HA 1GWCA 2PN8A 2DJKA 1RQMA 4N0VA 5CRDA 4GSTA 4XS6A 5DALA 4PUFC 2K8SA 3VWUA 2EFEA 1GTBA 1YEPA 3ISOA 4E8HA 2DMLA 2M72A 4ZB8A 3V1WA 3GRXA 3ERFA 5D73A 4IHUA 3EMPA 3DWVA 4K5SA 2E7PA 2L4CA 2FUG2 2OA7A 1JLVA 2PU9C 3D4TA 1YEXA 5KOXA 5LNKe 4I97A 5GSSA 1GUMA 1XVWA 2FD3A 2LJAA 3F3QA 3KIJA 4XHMA 4HUAA 3KJYA 4ICYA 3I6AA 2HI7A 4GDFA 4CY8A 3US3A 4XTSA 4KDXA 4HS1A 1MDJA 2H1DA 2H71A 1ZCPA 4F9ZA 3ZITA 3D4MA 5ENUA 3A2WA 1QUWA 5GAPD 4IVFA 3RHBA 7GSSA 5BMUA 4Z7XA 1TKDB 4O5QA 3VPTA 3F6DA 3P90A 1Y1UA 3GUSA 1GH2A 4MH2A 5IOWA 4AKIA 1SJZA 1XOAA 2HXKA 4PGTA 4ML1A 4O5UA 5CNWA 3A2XA 1MEKA 1ZOFA 3IV4A 1YZXA 3UVTA 2PUKC 4IJ3A 2N5AA 1QXHA 3KD0A 4LLRA 5D9WA 5DCHA 3RDWA 1GTUA 2JSYA 3QD9A 4TXVA 3MAKA 2H0IA 1FB6A 4DSRA 1PN9A 1SD9A 1PKZA 2X4AA 3W8SA 1MD4A 1VF4A 3ZMKA 5DVBA 5H5RA 3TJKA 5HR3A 2VCVA 1HQOA 2G2QA 5KN2A 4ZL7A 4N10A 4AJ8A 4EDYA 1XPVA 4GWRA 2RLIA 1PRXA 3UARA 5G31A 2HRFA 2V32A 3G7IA 2WRTA 3M1GA 1ZYEA 1GSDA 1WMJA 5F0GA 4MH3A 1PSQA 3TDGA 14GSA 1F9MA 2P0GA 1S3CA 2GZYA 2DBCA 4BA7A 2FNOA 1SL1B 1GSEA 1X5DA 2HRAA 2LQQA 4PTSA 4JE1A 4GXZA 2FHEA 2KLXA 4Q5NA 3LG6A 2IMFA 1SKWB 1TRSA 1SYRA 4TR3A 2VLVA 2E0QA 4K7NA 1EV9A 4K9ZA 3VK9A 1R5AA 3Q6OA 4JBBA 3VI5A 3BJ5A 1HNCA 5L71A 1BF5A 5B7CA 2OKAA 2R0GA 2C1YA 3PR8A 3KMNA 1X9WB 2CAQA 3ME8A 12GSA 3EVIA 1N2AA 4Q5RA 4K0NA 3SWLA 5GAND 3IR4A 4HQSA 3F6FA 3F8UA 4ZB7A 5ELGA 1EWXA 3CSHA 1U3AA 2NVLA 3TKSE 3I69A 2WULA 5AISA 4N11A 2VL3A 4OO4A 3ERGA 2OBKA 5HR2A 2YWMA 4OFMA 4K2DA 2WDUA 1H75A 2B1LA 4AJ6A 2FWEA 3GKNA 1XZOA 2YWOA 2O89A 5B8BA 2GDRA 2L5LA 2VCTA 2MMOA 3F0IA 3VURA 3M9JA 2RUFA 3HMJG 1XW6A 2H66A 4LA1A 2YWNA 4IP6A 2MMZA 3F3RA 2LRCA 2YANA 2HSMB 1X0RA 3HZ8A 4ILFA 3GL5A 11GSA 3C1SA 3E3EA 3GX0A 2H74A 4A5PA 4MPFA 4XS4B 1S3DA 2GS3A 4PNGA 2TRCP 5AGYA 4ZILA 2DC5A 2FCHA 1K0CA 3ZRDA 1K3YA 1K3OA 2DJ2A 3IXRA 4MK3A 3OR5A 3HZ4A 3DD3A 2WGRA 3PGTA 2LV3A 1EV4A 2UV8G 5ID2B 2GVPA 4IKHA 2AV4A 2HYXA 2CVDA 1FOHA 4Z2UA 4IGJA 4EKZA 5B8AA 4BWSA 5ECLB 6GSVA 2C0FA 3MIXA 3HJMA 2OADA 4TRXA 1U87A 4TOPA 1QQ2A 2YWIA 4ZB9A 2LEGA 1HD2A 4L0WA 3N9JA 3W8JA 3F4SA 2BTOT 2JL4A 5HQPA 2MYGA 1PN0A 3IHQA 3AY8A 4HJ2A 1VF2A 4E8EA 2LS5A 3F4TA 3CSIA 2KHPA 1HNAA 4YQMA 2H70A 3QOUA 1GNEA 2H75A 1Y6EA 3TJFA 4MA9A 1M9AA 4N0ZA 1J08A 4O92A 1SVLA 2R6KA 4PQ1A 2VLUA 3C8EA 3HVSA 5F06A 5J47A 2K6VA 3LXZA 2DSAA 4TW5A 2L4QA 1YY7A 5CO3A 4KF9A 3RPNA 3DKSA 3WGDA 3ZIJA 1TK5B 1V98A 3KEBA 3SBCA 3HD5A 1ACVA 3C73A 4DSQA 3A5WA 3LW9A 5ECOB 4YKGA 2B6MA 3TGZA 1CQHA 3CTFA 3D6IA 1KBNA 2H1LA 2A2RA 3FZ4A 4IJIA 3IK9A 4JZQA 3IOSA 1I9DA 3KCMA 2XPDA 5GSTA 1T1VA 3A3TA 4ZIJA 5J9BA 2YP6A 2CAIA 2EFCA 2X49A 2K9FA 5HFGA 1BG1A 4MJAA 4YKFA 3DEXA 2L5OA 3TOUA 1R5PA 1N25A 2O8VB 4MZBA 4EDZA 5JCUA 1AUCA 3GSSA 2X8HA 1SVMA 4E68A 2TIRA 3FW2A 1E2YA 2IL3A 4GTUA 4JR4A 3TCOA 2NPBA 3D0ZA 1WJKA 1B4PA 1TU7A 2C3NA 5FT3A 3LYKA 1FB0A 2H76A 3ZTLA 5IM9A 5GZZB 4V2MA 1OAZA 4TN8A 2C3QA 1TXXA 2LQOA 2PPTA 4ZL8A 5A5HB 2KP1A 3LORA 3CRUA 1Z3EA 4ISDA 3EINA 5ECMB 5J40A 2EIOA 3K8NA 5J4UA 2P5QA 3M3MA 4BL7B 1PGTA 5IPGA 5A4VA 6GSYA 1TJDA 3CWGA 1TDIA 4Q5QA 5DQYA 3ZYWA 2QKEA 4LL4B 3DIEA 4DEJA 1M9BA 3KMOA 2WCIA 4F0BA 1GLQA 4WBJA 5IIZA 1EGRA 5JCGA 3UJ1A 2VUPA 2LRNA 2HSMA 3TRXA 5CREA 2AYTA 3MWHA 2LNSA 2IWTA 4K2XA 1PL2A 2CT6A 4I5QA 4IP1A 1YJ6A 2LKUA 1G7EA 4WEYA 2YCDA 1K0OA 2JSZA 4XS4A 1Z6NA 5IQYA 4I8BA 5IO0A 1THXA 5HR0A 1XWAA 2PBJA 3TOTA 1GUHA 1FVJA 1VGLA 4N3ZA 3IHGA 4IN0A 1SL2B 3G9BA 2B1KA 4OCEA 3HKRA 1V2AA 5ID2A 2GT6A 1KNGA 5DJMA 1GL8A 5IMZA 3TKPA 2VL9A 4HU7A 1NSWA 3D22A 4POBA 2YV7A 3U5RE 1AQVA 4KH7A 1SENA 2VOCA 1ERWA 5C00A 3C7MA 2GTUA 3ZVJD 2F3MA 2BJXA 4K7IA 4V2LA 2E2GA 4KGIA 2LJKA 4PURA 3GFKA 2IMDA 2M46A 5AIXA 2B5YA 4WBRD 4ULXA 18GSA 2QSIA 1AXDA 9GSSA 3GURA 1QGVA 5DCGA 3WGXA 3HY2A 2V6KA 3U6VA 4FYCA 1A0FA 2C3TA 2IMIA 2JU5A 1OKDA 1V40A 5ECIB 3PH9A 1W89A 4IQ1A 4YQVA 3M0FA 5EVOA 1ZYNA 4Z2RA 4KDUA 6GSUA 3TJJA 4WR5A 4GRFA 2DLXA 1J0FA 5ECHB 2FLSA 5KEJA 3NIVA 2JZTA 1GTAA 2B5EA 1BAYA 5J5NA 3Q19A 2VL2C 2R37A 3DXBA 4RUVA 3FHKA 1KEBA 3CMIA 4EL1A 4LMVA 2K8VA 1RW1A 2K18A 4BWQA 1OKTA 3TRQA 4QL9A 1WP0A 1GLPA 3IAS2 4K0GA 5J3RA 4RQRA 5DAKB 3GH9A 3GN3A 4XCSA 4O7HA 4IQAA 4G0IA 2OE3A 3EYTA 4X0XA 2GZPA 4W66A 4IELA 1TI1A 1WPIA 4V2NA 5G2ZA 3QAVA 5G5EA 1O8WA 4AF2A 1LJRA 5HFIA 5G5FA 2VCZA 1DUGA 4IS0A 1O6JA 5A5KA 5IMCA 2DJJA 4DSSB 2PMTA 4POKA 5KN3A 4USSA 1ERUA 1T3BA 3IC8A 2HZEB 3QAGA 3FY7A 1GTIA 4MCUA 3IA1A 2YOIA 2H6XA 1WWJA 4PUAA 3FMWA 22GSA 3O3TA 2OBIA 2V1MA 4EF0A 1JFUA 4WF5A 4JRRA 3L9UA 5A5HA 6GSSA 4F82A 5FHIA 4H86A 2GLRA 4AKXB 2QGVA 4JU5A 4F2IA 4AJ7A 2DJ0A 4BL7A 2IPAA 1PQNA 4ECIA 4XS1A 1ILOA 1TRUA 6GSXA 5D93A 3GKXA 2VO4A 5CP1A 1TXUA 3WT1A 2HZFA 4D73B 1JHBA 2Z9SA 1F3AA 1ZL9A 3GKMA 1R7HA 2XC2A 2R0PA 1GSSA 5HFKA 3GV1A 4KB3A 2C4JA 1G0TA 4NAXA 5ECRB 1NW2A 3ME7A 2DKHA 4PQHA 2H1BA 2EFHA 2V2GA 2VIMA 3QDNA 4RQXA 3GTUB 5DQSA 4G9HA 4I2UA 1HYUA 1JZOA 2YN1A 4HJMA 2H1AA 4J57E 3NOFA 2UZ8A 2F8FA 2KP2A 2FA4A 1GNWA 3I43A 2LRTA 3HVVA 5CAXA 2LJRA 1N8JA 3E9JB 3O76A 4MJBA 2HRNA 2M80A 2AHEA 2JZSA 4HQZA 5AIVA 1XVQA 5B6MA 1YVLA 3LJRA 3FYGA 4WR4A 4MF5A 1DE1A 4YAPA 2HSYA 5G1KA 5ECKB 3PINA 6GSTA 2YV9A 2EIQA 1PX7A 1EEMA 2GZZA 1JLWA 5JWOB 2I81A 4BVYB 1MTCA 2LTKA 3QMXA 1URMA 5FWGA 2J9HA 2C0GA 1T4YA 2VCXA 2H19A 1A8LA 5IMAA 1K3LA 3FRCA 1UN2A 2WFCA 1OE7A 1XWBA 2H6ZA 2HSNB 3MYDA 2DIYA 3MNGA 5IMFA 5HR1A 1OC9B 2J23A 4YH2A 3QFAC 4KA0A 2GSSA 1OVNA 4HZ4A 1XCCA 3QAWA 3UVHA 3TJBA 3P7XA 2RIIA 1XW5A 4CY6A 3VWXA 5D9VA 4IBPA 3J7Yb 1X5CA 3UBKA 1O81A 4EO3A 3IRAA 4NPBA 2YPMA 2CA8A 3GX8A 1K0MA 1R26A 3A5IA 3JCML 4MJCA 2VL2A 3VPQA 1C72A 1B8XA 2PGTA 1IYIA 3H1NA 2QA2A 3KP9A 4K5RA 5DAKA 2ZNMA 1CQGA 5IMVA 3IAM2 1U6TA 1UC7A 2MBSA 5D96A 2R5GA 4POLA 3IE3A 3GL3A 1FHEA 4KX4A 3LXTA 2GQMA 5COHA 3WD6A 4CHSA 2D2ZA 4NMUA 3WGEA 2IN3A 2B3SA 4F0CA 2VD1A 1GULA 5E59A 1SJ6A 4OO5A 3C1RA 2HNLA 4NV2A 2H0GA 3FK8A 4DSSA 1SYXA 2L57A 4HOJA 2VLTA 1PL1A 1LBKA 1XOBA 4TKYA 3GKKA 2HZEA 4TR1B 5ELAA 1SKSB 2XHFA 3IDVA 4WF4A 1V57A 4RI6A 3KXOA 2X99A 1T00A 3H79A 1MDKA 5CRHA 2MZCA 2E2MA 5BRTA 2H6YA 4HDEA 2BMXA 4X1UA 1ERVA 1K0NA 2NTOA 3CYNA 5CYYA 2KOKA 3Q18A 1ZZYA 4EC0A 5IOXA 3L9VA 4KAEA 4LL1B 4D73A 1GSUA 4KE3A 5JCWA 1F3BA 1AIUA 5IO2A 2GSRA 2IMEA 1EP7A 2WS2A 4LMWA 3GMFA 2F51A 3R2QA 2GSTA 2XPEA 4G10A 2B5XA 2O5VA 1J9BA 3H4KA 1ZYQB 4ECJA 3RBTA 5IPHA 2GSQA 2IFQB 3MSZA 3GTUA 3ZREA 1SL0B 1I5GA 4AI6A 5ECPB 4GLTA 2X8GA 2A4HA 4P3YB 2H8LA 1A2JA 4KDYA 2B7JA 3LEFA 17GSA 1JZRA 2ZCTA 2YZUA 4Z2TA 3J7Yk 4FYBA 2H73A 2HT9A 4J2FA 3L4NA 1B9XC 3CXGA 2FWFA 1VF1A 1B9YC 5A1NB 4GF0A 3FEUA 4K8MA 4MF7A 3TU3B 3QCPA 4YAVA 3RHCA 2DJ3A 2HE3A 2C0DA 1K0BA 4QL7A 3KP8A 1G7OA 1XWCA 1YKCA 1SD8A 4BVYA 2CX4A 2RM6A 5JWRB 1THOA 5KOWA 4OMVA 1X5EA 2QC7A 4I6XA 2CQ9A 16GSA 2AUVA 2LUSA 1M2DA 3TKSC 4ACSA 4ZBBA 3GA4A 4NXIA 4GQFA 1PKWA 1FVKA 3LFLA 3DMLA 1QMVA 1TRWA 5G1LA 1S3AA 3KH9A 2HSNA 1TI3A 2VM2A 3ZMLA 2R0CA 1OC9A 1A23A 3G7YA 4L0UA 3D21A 4GSSA 1NHYA 4AKHA 1TU8A 4FYUA 3HYPA 2VM1A 5JWQB 3WT2A 3FR9A 4NV5A 1M2AA 3EU4A 1PMTA 2JADA 3UMAA 4KNDA 1Q4JA 3M9KA 1U88A 4ZB6A 2L59A 3TUEA 3F4RA 3UBLA 3NZNA 3DVXA 1ERTA 4GCIA 1EOGA 1BX9A 5DBQA 3M8NA 2VCQA 1NM3A 3ERWA 1V58A 5A34B 2IIYA 3ZLPA 5F07A 4WKWA 1WOUA 3IBHA 5ECNB 2OT3A 4OFTA 4OCFA 3W6GA 1ZYPA 2I1UA 1FAAA 2DMMA 2DKIA 4BVXB 5H5SA 3VWVA 2B7KA 4KW6A 4TVEA 3GYKA 3DRNA 4CW9A 5ABRA 4WETA 1O8XA 2H0HA 2LNTA 2TRXA 2H01A 3KTBA 3UL3A 1DBYA 1TRVA 1FO5A 1GRXA 4ML6A 3LQ7A 5LCZA 1UA5A 3ZIVA 2AB6A 1RK4A 4PQIA 1GSYA 2JZRA 2HRKB 3VI7A 5EY6A 2CZ3A 3D5JA 4TR1A 3ZVJA 1SVOA 3BD2A 1B48A 2OE0A 4TR4A 4KCAA 1ML6A 4O32A 4Q5FA 5KN1A 2A4VA 3FZ9A 4HI7A 3KM6A 1T7PB 3HCZA 4EVMA 1SK1A 4MZCA 2C80A 4QQ7A 4NWYA 4EIPA 1M99A 2I4AA 4FQUA 3BBYA 19GSA 4FH8A 5DJLA 4J56E 2X8CA 1A0RP 3VWWA 3HA9A 4XIHA 3H93A 4KUNA 1A2LA 4OD7A 1Y25A 4KSMA 1BEDA 1Z7PA 2JACA 1WE0A 1YF0A 4X4JA 2R2JA 4KCEA 1O7UA 2I3YA 2IFQA 4RI7A 2WZ9A 1QFNA 5E4WA 4MP4A 1X9MB 2PVQA 4HEA2 2HQTA 2CVKA 2P31A 1QK8A 3GH6A 1YDKA 3FR3A 2MMAA 2WB9A 5J9CA 3Q74A 1BG5A 2ON7A 4XRDA 3C71A 5A1NA 1DSBA 4MLYA 4AKGA 1G6WA 3A2VA 3QFBC 4NHZA 1ABAA 1YQ1A 4FO5A 4PX1A 5EL8A 1FG4A 3KGKA 4G01A 4MPGA 3GIXA 1XBSA 4G19A 5EPFA 2N5BA 2PVOC 3FZ5A 1WRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LU4 A;  3FKF A;  4ZL9 A;  4MF6 A;  4K6X A;  2L6C A;  4OFN A;  3DGQ A;  1EEJ A;  4OWY A;  2CV4 A;  3EWL A;  4ID0 A;  4XRA A;  3RAZ A;  3ZL5 A;  2CX3 A;  1UVZ A;  1SU9 A;  2P5R A;  1SJI A;  3TKS A;  3H8Q A;  1USB A;  3EUR A;  4TXO B;  1HNB A;  3IPZ A;  4HZ2 A;  3RPP A;  2H1G A;  5AN1 A;  1PX6 A;  1T8E B;  3HHV A;  4JED A;  3VFI A;  4X43 A;  3BCK A;  2NBS A;  3APQ A;  4N30 A;  1F2E A;  1GP1 A;  4YQU A;  3FZA A;  2O7K A;  3ZFB A;  1JZW A;  4EUY A;  1ZMA A;  3IK7 A;  4K7O A;  3UEM A;  1BQ7 A;  4AGS A;  4L5L A;  4G0L A;  3L78 A;  2C8U A;  2DIZ A;  1F37 A;  1ZGN A;  1EP8 A;  1O73 A;  1ST9 A;  1Z9H A;  1VF3 A;  3EE2 A;  2MBT A;  3IC4 A;  10GS A;  1TOF A;  4L8E A;  4NHW A;  4BVX A;  2EIR A;  3GHA A;  4GQC A;  2OJL A;  5DAL B;  1MDI A;  8GSS A;  3QPM A;  1OC3 A;  3F63 A;  4EE0 A;  3PPU A;  4BPY A;  4ECC A;  1SKR B;  4FIW A;  3HJO A;  4O5R A;  2N5F A;  5CRG A;  2LST A;  1EZK A;  1Q98 A;  1IYH A;  2GT5 A;  1FW1 A;  3G7J A;  2A2S A;  3LGC A;  4L5O A;  2EC4 A;  1FOV A;  1G6Y A;  1OE8 A;  3EC3 A;  2R4V A;  3GNJ A;  2R3X A;  2O85 A;  2HRK A;  3VLN A;  2WJU A;  1R4W A;  4MJE A;  3O6T A;  2H30 A;  2GGT A;  13GS A;  2G0F A;  1B4Q A;  5CRW A;  2XBQ A;  1SK2 A;  2YJ7 A;  5D8I A;  1OYJ A;  4HU9 A;  4V1A g;  1TW9 A;  2HFD A;  4K1F A;  2FWG A;  4MMM A;  1E6B A;  3TJG A;  4PXO A;  5IMD A;  2CVB A;  4MDC A;  1PD2 1;  2H72 A;  2REM A;  1A2M A;  1JZD A;  2KUC A;  3EU3 A;  2ON5 A;  3UAP A;  2FY6 A;  2FGX A;  1M0U A;  2F8A A;  1VRS D;  2V41 A;  4MAB A;  3QR6 A;  3LWA A;  3HJP A;  1PA3 A;  1V9W A;  4MZW A;  4ZBA A;  1NHO A;  1BJX A;  5A4W A;  1BYE A;  2VD0 A;  1AAZ A;  3FR6 A;  3BCI A;  3F9U A;  1H4O A;  2CZ2 A;  2YJH A;  1AC1 A;  1XWG A;  2VCW A;  4G0K A;  1W4V A;  1SK0 A;  3BOA A;  4POM A;  1XIY A;  1MD3 A;  3APO A;  3WYW A;  5J41 A;  2O87 A;  1XXU A;  3TB2 A;  3LSZ A;  2AJQ B;  2FWH A;  2ES7 A;  1X9S B;  1ON4 A;  1K0A A;  2MMN A;  1GSQ A;  4PNF A;  4ZBD A;  1GSF A;  3DVW A;  3UOM A;  4IW9 A;  2VAF A;  3UIW A;  3HVX A;  2FA8 A;  2XBI A;  2PWJ A;  3CRT A;  2HSH A;  5D9T A;  1Z7R A;  2ZUP A;  1TK8 B;  5ECS A;  2YNX A;  3L9S A;  4KSO A;  1EOH A;  3EMX A;  1EGO A;  2IMK A;  3HDC A;  4TR0 A;  2AAW A;  2L6D A;  1K0D A;  3CTG A;  6GSW A;  1A24 A;  4I2T A;  2RUE A;  1Z6M A;  3DYR A;  2YZH A;  5KN0 A;  2PER A;  3KTL A;  3TRP A;  1DE2 A;  3CBU A;  4ZXG A;  1F6M C;  4V1A p;  5F05 A;  2V6O A;  3S9F A;  1T4Z A;  1GUK A;  1AW9 A;  3CSJ A;  3TKR A;  5C04 A;  3N5O A;  3APS A;  5ECQ B;  2C0E A;  2OAC A;  2GQL A;  3ZFL A;  1TP9 A;  3P2A A;  4GSN A;  1WIK A;  4TXO A;  1XFL A;  1U3I A;  4JR6 A;  3GST A;  5H5Q A;  1TK0 B;  4WXT A;  5INY A;  3MDK A;  2IJY A;  1KTE A;  1AQW A;  1TTZ A;  2RM5 A;  2I9H A;  4EXJ A;  2X64 A;  1YKA A;  1M7T A;  3LYP A;  3P8W A;  3E0U A;  5DDL A;  5F8B A;  1Z5Y E;  5G30 A;  1AQX A;  3R3E A;  5B6N A;  4ECB A;  1OC8 A;  3HXS A;  2NDO A;  5LD0 A;  1A8Y A;  1O85 A;  3KZQ A;  2DJ1 A;  4DVC A;  1XWK A;  2OE1 A;  2F9S A;  5D9X A;  3KH7 A;  2HLS A;  4CDO A;  2ALB A;  2GQK A;  3TKQ A;  3ED3 A;  1M2B A;  20GS A;  4F03 A;  3ZZX A;  1YF1 A;  3I9V 2;  4G2E A;  5A4U A;  1XW9 A;  3L0H A;  1GWC A;  2PN8 A;  2DJK A;  1RQM A;  4N0V A;  5CRD A;  4GST A;  4XS6 A;  5DAL A;  4PUF C;  2K8S A;  3VWU A;  1GTB A;  1YEP A;  3ISO A;  4E8H A;  2DML A;  2M72 A;  4ZB8 A;  3V1W A;  3GRX A;  3ERF A;  5D73 A;  4IHU A;  3EMP A;  3DWV A;  2E7P A;  2L4C A;  2FUG 2;  2OA7 A;  1JLV A;  2PU9 C;  3D4T A;  1YEX A;  5LNK e;  4I97 A;  5GSS A;  1GUM A;  1XVW A;  2FD3 A;  2LJA A;  3F3Q A;  3KIJ A;  4XHM A;  4HUA A;  3KJY A;  3I6A A;  2HI7 A;  3US3 A;  4XTS A;  4KDX A;  4HS1 A;  1MDJ A;  2H1D A;  2H71 A;  1ZCP A;  4F9Z A;  3ZIT A;  3D4M A;  5ENU A;  3A2W A;  1QUW A;  5GAP D;  4IVF A;  3RHB A;  7GSS A;  5BMU A;  4Z7X A;  1TKD B;  3VPT A;  3F6D A;  3P90 A;  3GUS A;  4MH2 A;  1GH2 A;  5IOW A;  1SJZ A;  1XOA A;  2HXK A;  4PGT A;  4ML1 A;  5CNW A;  3A2X A;  1MEK A;  1ZOF A;  3IV4 A;  1YZX A;  3UVT A;  2PUK C;  4IJ3 A;  2N5A A;  1QXH A;  3KD0 A;  4LLR A;  5D9W A;  5DCH A;  3RDW A;  1GTU A;  2JSY A;  3QD9 A;  4TXV A;  3MAK A;  2H0I A;  1FB6 A;  4DSR A;  1PN9 A;  1SD9 A;  1PKZ A;  3W8S A;  1MD4 A;  1VF4 A;  3ZMK A;  5DVB A;  5H5R A;  3TJK A;  5HR3 A;  2VCV A;  1HQO A;  2G2Q A;  5KN2 A;  4ZL7 A;  4N10 A;  4AJ8 A;  4EDY A;  1XPV A;  4GWR A;  2RLI A;  1PRX A;  3UAR A;  5G31 A;  2HRF A;  2V32 A;  3G7I A;  2WRT A;  3M1G A;  1ZYE A;  1GSD A;  1WMJ A;  5F0G A;  4MH3 A;  1PSQ A;  3TDG A;  14GS A;  1F9M A;  2P0G A;  1S3C A;  2GZY A;  2DBC A;  4BA7 A;  2FNO A;  1SL1 B;  1GSE A;  1X5D A;  2HRA A;  2LQQ A;  4PTS A;  4JE1 A;  4GXZ A;  2FHE A;  2KLX A;  4Q5N A;  3LG6 A;  2IMF A;  1SKW B;  1TRS A;  1SYR A;  4TR3 A;  2VLV A;  2E0Q A;  4K7N A;  1EV9 A;  4K9Z A;  3VK9 A;  1R5A A;  3Q6O A;  4JBB A;  3VI5 A;  3BJ5 A;  1HNC A;  5L71 A;  5B7C A;  2OKA A;  2C1Y A;  3PR8 A;  3KMN A;  1X9W B;  2CAQ A;  3ME8 A;  12GS A;  3EVI A;  1N2A A;  4Q5R A;  4K0N A;  3SWL A;  5GAN D;  3IR4 A;  4HQS A;  3F6F A;  3F8U A;  5ELG A;  1EWX A;  3CSH A;  1U3A A;  2NVL A;  3TKS E;  3I69 A;  2WUL A;  5AIS A;  4N11 A;  2VL3 A;  4OO4 A;  3ERG A;  2OBK A;  5HR2 A;  2YWM A;  4OFM A;  4K2D A;  2WDU A;  1H75 A;  2B1L A;  4AJ6 A;  2FWE A;  3GKN A;  1XZO A;  2YWO A;  2O89 A;  5B8B A;  2GDR A;  2L5L A;  2VCT A;  2MMO A;  3F0I A;  3VUR A;  3M9J A;  2RUF A;  1XW6 A;  2H66 A;  4LA1 A;  2YWN A;  4IP6 A;  2MMZ A;  3F3R A;  2LRC A;  2YAN A;  2HSM B;  1X0R A;  3HZ8 A;  4ILF A;  3GL5 A;  11GS A;  3C1S A;  3E3E A;  3GX0 A;  2H74 A;  4MPF A;  4XS4 B;  1S3D A;  2GS3 A;  4PNG A;  2TRC P;  5AGY A;  4ZIL A;  2DC5 A;  2FCH A;  1K0C A;  3ZRD A;  1K3Y A;  1K3O A;  2DJ2 A;  3IXR A;  4MK3 A;  3OR5 A;  3HZ4 A;  3DD3 A;  2WGR A;  3PGT A;  2LV3 A;  1EV4 A;  5ID2 B;  2GVP A;  4IKH A;  2AV4 A;  2HYX A;  2CVD A;  4IGJ A;  4EKZ A;  5B8A A;  4BWS A;  5ECL B;  6GSV A;  2C0F A;  3HJM A;  2OAD A;  4TRX A;  1U87 A;  4TOP A;  1QQ2 A;  2YWI A;  4ZB9 A;  2LEG A;  1HD2 A;  4L0W A;  3N9J A;  3W8J A;  3F4S A;  2BTO T;  2JL4 A;  5HQP A;  2MYG A;  3IHQ A;  3AY8 A;  4HJ2 A;  1VF2 A;  4E8E A;  2LS5 A;  3F4T A;  3CSI A;  2KHP A;  1HNA A;  4YQM A;  2H70 A;  3QOU A;  1GNE A;  2H75 A;  1Y6E A;  3TJF A;  4MA9 A;  1M9A A;  4N0Z A;  1J08 A;  4O92 A;  2R6K A;  4PQ1 A;  2VLU A;  3C8E A;  3HVS A;  5F06 A;  2K6V A;  3LXZ A;  2DSA A;  4TW5 A;  2L4Q A;  1YY7 A;  5CO3 A;  4KF9 A;  3RPN A;  3DKS A;  3WGD A;  3ZIJ A;  1TK5 B;  1V98 A;  3KEB A;  3SBC A;  3HD5 A;  1ACV A;  3C73 A;  4DSQ A;  3A5W A;  5ECO B;  2B6M A;  3TGZ A;  1CQH A;  3CTF A;  3D6I A;  1KBN A;  2A2R A;  3FZ4 A;  4IJI A;  3IK9 A;  4JZQ A;  3IOS A;  1I9D A;  3KCM A;  2XPD A;  5GST A;  1T1V A;  3A3T A;  4ZIJ A;  5J9B A;  2YP6 A;  2CAI A;  2K9F A;  5HFG A;  4MJA A;  3DEX A;  2L5O A;  3TOU A;  1R5P A;  2O8V B;  4MZB A;  4EDZ A;  5JCU A;  1AUC A;  3GSS A;  2X8H A;  2TIR A;  3FW2 A;  1E2Y A;  2IL3 A;  4GTU A;  4JR4 A;  3TCO A;  2NPB A;  3D0Z A;  1WJK A;  1B4P A;  1TU7 A;  2C3N A;  5FT3 A;  3LYK A;  1FB0 A;  2H76 A;  3ZTL A;  5IM9 A;  5GZZ B;  4V2M A;  1OAZ A;  4TN8 A;  2C3Q A;  1TXX A;  2LQO A;  2PPT A;  4ZL8 A;  2KP1 A;  3LOR A;  3CRU A;  1Z3E A;  4ISD A;  3EIN A;  5ECM B;  2EIO A;  3K8N A;  5J4U A;  2P5Q A;  3M3M A;  4BL7 B;  1PGT A;  5IPG A;  5A4V A;  6GSY A;  1TJD A;  1TDI A;  4Q5Q A;  5DQY A;  3ZYW A;  2QKE A;  4LL4 B;  3DIE A;  4DEJ A;  1M9B A;  3KMO A;  2WCI A;  4F0B A;  1GLQ A;  4WBJ A;  5IIZ A;  1EGR A;  5JCG A;  3UJ1 A;  2VUP A;  2LRN A;  2HSM A;  3TRX A;  5CRE A;  2AYT A;  3MWH A;  2LNS A;  2IWT A;  1PL2 A;  2CT6 A;  4I5Q A;  4IP1 A;  1YJ6 A;  2LKU A;  1G7E A;  4WEY A;  2YCD A;  1K0O A;  2JSZ A;  4XS4 A;  1Z6N A;  5IQY A;  4I8B A;  5IO0 A;  1THX A;  5HR0 A;  1XWA A;  2PBJ A;  3TOT A;  1GUH A;  1FVJ A;  1VGL A;  4IN0 A;  1SL2 B;  3G9B A;  2B1K A;  4OCE A;  3HKR A;  1V2A A;  5ID2 A;  2GT6 A;  1KNG A;  5DJM A;  1GL8 A;  5IMZ A;  3TKP A;  2VL9 A;  4HU7 A;  1NSW A;  3D22 A;  4POB A;  2YV7 A;  3U5R E;  1AQV A;  4KH7 A;  1SEN A;  2VOC A;  1ERW A;  5C00 A;  3C7M A;  2GTU A;  3ZVJ D;  2F3M A;  2BJX A;  4K7I A;  4V2L A;  2E2G A;  4KGI A;  2LJK A;  4PUR A;  3GFK A;  2IMD A;  2M46 A;  5AIX A;  2B5Y A;  4WBR D;  4ULX A;  18GS A;  2QSI A;  1AXD A;  9GSS A;  3GUR A;  1QGV A;  5DCG A;  3WGX A;  3HY2 A;  2V6K A;  3U6V A;  4FYC A;  1A0F A;  2C3T A;  2IMI A;  2JU5 A;  1OKD A;  1V40 A;  5ECI B;  3PH9 A;  1W89 A;  4IQ1 A;  4YQV A;  3M0F A;  5EVO A;  4KDU A;  6GSU A;  3TJJ A;  4WR5 A;  4GRF A;  2DLX A;  1J0F A;  5ECH B;  2FLS A;  5KEJ A;  3NIV A;  2JZT A;  1GTA A;  2B5E A;  1BAY A;  5J5N A;  3Q19 A;  2VL2 C;  2R37 A;  3DXB A;  4RUV A;  3FHK A;  1KEB A;  3CMI A;  4EL1 A;  4LMV A;  2K8V A;  1RW1 A;  2K18 A;  4BWQ A;  1OKT A;  3TRQ A;  4QL9 A;  1WP0 A;  1GLP A;  3IAS 2;  4K0G A;  5J3R A;  4RQR A;  5DAK B;  3GH9 A;  3GN3 A;  4XCS A;  4O7H A;  4IQA A;  4G0I A;  2OE3 A;  3EYT A;  4X0X A;  2GZP A;  4IEL A;  1TI1 A;  1WPI A;  4V2N A;  5G2Z A;  3QAV A;  5G5E A;  1O8W A;  4AF2 A;  1LJR A;  5HFI A;  5G5F A;  2VCZ A;  1DUG A;  4IS0 A;  1O6J A;  5A5K A;  5IMC A;  2DJJ A;  4DSS B;  2PMT A;  4POK A;  5KN3 A;  4USS A;  1ERU A;  1T3B A;  3IC8 A;  2HZE B;  3QAG A;  3FY7 A;  1GTI A;  4MCU A;  3IA1 A;  2YOI A;  2H6X A;  1WWJ A;  4PUA A;  22GS A;  3O3T A;  2OBI A;  2V1M A;  4EF0 A;  1JFU A;  4WF5 A;  4JRR A;  3L9U A;  6GSS A;  4F82 A;  5FHI A;  4H86 A;  2GLR A;  2QGV A;  4JU5 A;  4F2I A;  4AJ7 A;  2DJ0 A;  4BL7 A;  2IPA A;  1PQN A;  4ECI A;  4XS1 A;  1ILO A;  1TRU A;  6GSX A;  5D93 A;  3GKX A;  2VO4 A;  5CP1 A;  3WT1 A;  2HZF A;  4D73 B;  1JHB A;  2Z9S A;  1F3A A;  1ZL9 A;  3GKM A;  1R7H A;  2XC2 A;  1GSS A;  5HFK A;  3GV1 A;  4KB3 A;  2C4J A;  1G0T A;  4NAX A;  5ECR B;  1NW2 A;  3ME7 A;  4PQH A;  2H1B A;  2V2G A;  2VIM A;  3QDN A;  4RQX A;  3GTU B;  5DQS A;  4G9H A;  4I2U A;  1HYU A;  1JZO A;  2YN1 A;  4HJM A;  2H1A A;  4J57 E;  3NOF A;  2UZ8 A;  2F8F A;  2KP2 A;  2FA4 A;  1GNW A;  3I43 A;  2LRT A;  3HVV A;  5CAX A;  2LJR A;  1N8J A;  3E9J B;  3O76 A;  4MJB A;  2HRN A;  2M80 A;  2AHE A;  2JZS A;  4HQZ A;  5AIV A;  1XVQ A;  5B6M A;  3LJR A;  3FYG A;  4WR4 A;  4MF5 A;  1DE1 A;  4YAP A;  2HSY A;  5G1K A;  5ECK B;  3PIN A;  6GST A;  2YV9 A;  2EIQ A;  1PX7 A;  1EEM A;  2GZZ A;  1JLW A;  5JWO B;  2I81 A;  4BVY B;  1MTC A;  2LTK A;  3QMX A;  1URM A;  5FWG A;  2J9H A;  2C0G A;  1T4Y A;  2VCX A;  2H19 A;  1A8L A;  5IMA A;  1K3L A;  3FRC A;  1UN2 A;  2WFC A;  1OE7 A;  1XWB A;  2H6Z A;  2HSN B;  2DIY A;  3MNG A;  5IMF A;  5HR1 A;  1OC9 B;  2J23 A;  4YH2 A;  3QFA C;  4KA0 A;  2GSS A;  1OVN A;  4HZ4 A;  1XCC A;  3QAW A;  3UVH A;  3TJB A;  3P7X A;  2RII A;  1XW5 A;  3VWX A;  5D9V A;  4IBP A;  3J7Y b;  1X5C A;  3UBK A;  1O81 A;  4EO3 A;  3IRA A;  4NPB A;  2YPM A;  2CA8 A;  3GX8 A;  1K0M A;  1R26 A;  3JCM L;  4MJC A;  2VL2 A;  3VPQ A;  1C72 A;  1B8X A;  2PGT A;  1IYI A;  3H1N A;  3KP9 A;  5DAK A;  2ZNM A;  1CQG A;  5IMV A;  3IAM 2;  1U6T A;  1UC7 A;  2MBS A;  5D96 A;  2R5G A;  4POL A;  3IE3 A;  3GL3 A;  1FHE A;  4KX4 A;  3LXT A;  2GQM A;  5COH A;  3WD6 A;  4CHS A;  2D2Z A;  4NMU A;  3WGE A;  2IN3 A;  2B3S A;  4F0C A;  2VD1 A;  1GUL A;  5E59 A;  1SJ6 A;  4OO5 A;  3C1R A;  2HNL A;  4NV2 A;  2H0G A;  3FK8 A;  4DSS A;  1SYX A;  2L57 A;  4HOJ A;  2VLT A;  1PL1 A;  1LBK A;  1XOB A;  4TKY A;  3GKK A;  2HZE A;  4TR1 B;  5ELA A;  1SKS B;  2XHF A;  3IDV A;  4WF4 A;  1V57 A;  4RI6 A;  3KXO A;  2X99 A;  1T00 A;  3H79 A;  1MDK A;  5CRH A;  2MZC A;  2E2M A;  2H6Y A;  4HDE A;  2BMX A;  4X1U A;  1ERV A;  1K0N A;  2NTO A;  3CYN A;  5CYY A;  2KOK A;  3Q18 A;  1ZZY A;  4EC0 A;  5IOX A;  3L9V A;  4KAE A;  4LL1 B;  4D73 A;  1GSU A;  4KE3 A;  5JCW A;  1F3B A;  1AIU A;  5IO2 A;  2GSR A;  2IME A;  1EP7 A;  2WS2 A;  4LMW A;  3GMF A;  2F51 A;  3R2Q A;  2GST A;  2XPE A;  4G10 A;  2B5X A;  1J9B A;  3H4K A;  1ZYQ B;  4ECJ A;  3RBT A;  5IPH A;  2GSQ A;  2IFQ B;  3MSZ A;  3GTU A;  3ZRE A;  1SL0 B;  1I5G A;  5ECP B;  4GLT A;  2X8G A;  4P3Y B;  2H8L A;  1A2J A;  4KDY A;  2B7J A;  3LEF A;  17GS A;  1JZR A;  2ZCT A;  2YZU A;  3J7Y k;  4FYB A;  2H73 A;  2HT9 A;  4J2F A;  3L4N A;  1B9X C;  3CXG A;  2FWF A;  1VF1 A;  1B9Y C;  4K8M A;  4GF0 A;  3FEU A;  4MF7 A;  3QCP A;  4YAV A;  3RHC A;  2DJ3 A;  2HE3 A;  2C0D A;  1K0B A;  4QL7 A;  3KP8 A;  1G7O A;  1XWC A;  1YKC A;  1SD8 A;  4BVY A;  2CX4 A;  2RM6 A;  5JWR B;  1THO A;  4OMV A;  1X5E A;  2QC7 A;  4I6X A;  2CQ9 A;  16GS A;  2AUV A;  2LUS A;  1M2D A;  3TKS C;  4ACS A;  4ZBB A;  3GA4 A;  4NXI A;  4GQF A;  1PKW A;  1FVK A;  3LFL A;  3DML A;  1QMV A;  1TRW A;  5G1L A;  1S3A A;  3KH9 A;  1TI3 A;  2VM2 A;  3ZML A;  1OC9 A;  1A23 A;  3G7Y A;  4L0U A;  3D21 A;  4GSS A;  1NHY A;  1TU8 A;  4FYU A;  3HYP A;  2VM1 A;  5JWQ B;  3WT2 A;  3FR9 A;  4NV5 A;  1M2A A;  3EU4 A;  1PMT A;  2JAD A;  3UMA A;  4KND A;  1Q4J A;  3M9K A;  1U88 A;  4ZB6 A;  2L59 A;  3TUE A;  3F4R A;  3UBL A;  3NZN A;  3DVX A;  1ERT A;  4GCI A;  1EOG A;  1BX9 A;  5DBQ A;  3M8N A;  2VCQ A;  1NM3 A;  3ERW A;  1V58 A;  2IIY A;  3ZLP A;  5F07 A;  4WKW A;  1WOU A;  3IBH A;  5ECN B;  4OFT A;  4OCF A;  3W6G A;  2I1U A;  1FAA A;  2DMM A;  5H5S A;  4BVX B;  3VWV A;  2B7K A;  4KW6 A;  4TVE A;  3GYK A;  3DRN A;  4CW9 A;  5ABR A;  4WET A;  1O8X A;  2H0H A;  2LNT A;  2TRX A;  2H01 A;  3KTB A;  3UL3 A;  1DBY A;  1TRV A;  1FO5 A;  1GRX A;  4ML6 A;  3LQ7 A;  5LCZ A;  1UA5 A;  3ZIV A;  2AB6 A;  1RK4 A;  4PQI A;  1GSY A;  2JZR A;  2HRK B;  3VI7 A;  5EY6 A;  2CZ3 A;  3D5J A;  4TR1 A;  3ZVJ A;  3BD2 A;  1B48 A;  2OE0 A;  4TR4 A;  4KCA A;  1ML6 A;  4O32 A;  4Q5F A;  5KN1 A;  2A4V A;  3FZ9 A;  4HI7 A;  3KM6 A;  1T7P B;  3HCZ A;  4EVM A;  1SK1 A;  4MZC A;  2C80 A;  4QQ7 A;  4NWY A;  1M99 A;  2I4A A;  4FQU A;  3BBY A;  19GS A;  4FH8 A;  5DJL A;  4J56 E;  2X8C A;  1A0R P;  3VWW A;  3HA9 A;  4XIH A;  3H93 A;  4KUN A;  1A2L A;  4OD7 A;  1Y25 A;  4KSM A;  1BED A;  1Z7P A;  2JAC A;  1WE0 A;  1YF0 A;  2R2J A;  4KCE A;  1O7U A;  2I3Y A;  2IFQ A;  4RI7 A;  2WZ9 A;  1QFN A;  5E4W A;  4MP4 A;  1X9M B;  2PVQ A;  4HEA 2;  2HQT A;  2CVK A;  2P31 A;  1QK8 A;  3GH6 A;  1YDK A;  3FR3 A;  2MMA A;  2WB9 A;  5J9C A;  3Q74 A;  1BG5 A;  2ON7 A;  4XRD A;  3C71 A;  1DSB A;  4MLY A;  1G6W A;  3A2V A;  3QFB C;  4NHZ A;  1ABA A;  1YQ1 A;  4FO5 A;  4PX1 A;  5EL8 A;  1FG4 A;  3KGK A;  4MPG A;  3GIX A;  1XBS A;  4G19 A;  5EPF A;  2N5B A;  2PVO C;  3FZ5 A;  1WRY A; 
#chains in the Genus database with same CATH topology
 1LU4 A;  3FKF A;  4ZL9 A;  4MF6 A;  4K6X A;  2L6C A;  4OFN A;  3DGQ A;  1EEJ A;  4OWY A;  2CV4 A;  3EWL A;  4ID0 A;  4XRA A;  3RAZ A;  3ZL5 A;  2CX3 A;  1UVZ A;  1SU9 A;  2P5R A;  1SJI A;  3TKS A;  3H8Q A;  1USB A;  3EUR A;  4TXO B;  1HNB A;  3IPZ A;  4HZ2 A;  3RPP A;  2H1G A;  5AN1 A;  1PX6 A;  1T8E B;  4QMK A;  2WVX A;  3HHV A;  4JED A;  3VFI A;  4X43 A;  3BCK A;  2NBS A;  3APQ A;  4N30 A;  1F2E A;  1GP1 A;  4YQU A;  3FZA A;  2O7K A;  3ZFB A;  1JZW A;  4EUY A;  1ZMA A;  3IK7 A;  4K7O A;  3UEM A;  1BQ7 A;  4AGS A;  4L5L A;  4G0L A;  3L78 A;  5A34 A;  2C8U A;  2DIZ A;  4BIK A;  1F37 A;  1ZGN A;  1EP8 A;  1O73 A;  1ST9 A;  2A2P A;  1Z9H A;  1VF3 A;  3EE2 A;  2MBT A;  3IC4 A;  10GS A;  1TOF A;  4L8E A;  4NHW A;  4BVX A;  2EIR A;  5J4V A;  3GHA A;  4GQC A;  2OJL A;  5DAL B;  1MDI A;  8GSS A;  3QPM A;  1OC3 A;  3F63 A;  4EE0 A;  3PPU A;  4BPY A;  4ECC A;  1SKR B;  4FIW A;  3HJO A;  4O5R A;  2N5F A;  5CRG A;  2LST A;  1EZK A;  1Q98 A;  1IYH A;  2GT5 A;  1FW1 A;  3G7J A;  2A2S A;  3LGC A;  4L5O A;  2EC4 A;  1FOV A;  1G6Y A;  1OE8 A;  3EC3 A;  2R4V A;  3GNJ A;  4EIQ A;  2R3X A;  2O85 A;  2HRK A;  3VLN A;  2WJU A;  1R4W A;  4MJE A;  3O6T A;  2H30 A;  5J4Y A;  2GGT A;  13GS A;  2G0F A;  1B4Q A;  5CRW A;  2XBQ A;  1SK2 A;  2YJ7 A;  5D8I A;  1OYJ A;  4HU9 A;  4V1A g;  1TW9 A;  2HFD A;  4K1F A;  2FWG A;  4MMM A;  1E6B A;  3TJG A;  4PXO A;  5IMD A;  2CVB A;  4MDC A;  1PD2 1;  2H72 A;  2REM A;  1A2M A;  1JZD A;  2KUC A;  3EU3 A;  2ON5 A;  3UAP A;  2FY6 A;  2O36 A;  2VKZ G;  2FGX A;  1M0U A;  2F8A A;  1VRS D;  2V41 A;  4MAB A;  3QR6 A;  3LWA A;  3HJP A;  1PA3 A;  1V9W A;  4MZW A;  5BMU B;  4ZBA A;  1NHO A;  1BJX A;  5A4W A;  1BYE A;  2VD0 A;  1AAZ A;  3FR6 A;  3BCI A;  3F9U A;  1H4O A;  2CZ2 A;  2YJH A;  1AC1 A;  1XWG A;  2VCW A;  4G0K A;  1W4V A;  1SK0 A;  3BOA A;  4POM A;  1XIY A;  1MD3 A;  3APO A;  3WYW A;  5J41 A;  2O87 A;  3EPT A;  1XXU A;  3TB2 A;  3LSZ A;  2AJQ B;  2FWH A;  2ES7 A;  1X9S B;  1ON4 A;  1K0A A;  2MMN A;  1GSQ A;  4PNF A;  4ZBD A;  1GSF A;  4FXY P;  3DVW A;  3UOM A;  4IW9 A;  2VAF A;  3UIW A;  3HVX A;  2FA8 A;  2XBI A;  2PWJ A;  3CRT A;  2HSH A;  5D9T A;  1Z7R A;  2ZUP A;  1TK8 B;  5ECS A;  2YNX A;  3L9S A;  2QA1 A;  4KSO A;  1EOH A;  3EMX A;  1EGO A;  2IMK A;  3HDC A;  4TR0 A;  2AAW A;  2L6D A;  1K0D A;  3CTG A;  6GSW A;  1A24 A;  4I2T A;  2RUE A;  1Z6M A;  4MNN A;  3DYR A;  2YZH A;  3RFR C;  2EFD A;  2PER A;  3KTL A;  5KN0 A;  3TRP A;  1DE2 A;  3CBU A;  4ZXG A;  1F6M C;  4V1A p;  5F05 A;  2V6O A;  3S9F A;  1T4Z A;  1GUK A;  1AW9 A;  3CSJ A;  3TKR A;  5C04 A;  3N5O A;  3RGB C;  3APS A;  5ECQ B;  2C0E A;  2OAC A;  2GQL A;  3ZFL A;  1TP9 A;  3P2A A;  4GSN A;  1WIK A;  4TXO A;  1XFL A;  1U3I A;  4JR6 A;  3GST A;  5H5Q A;  1TK0 B;  4WXT A;  5INY A;  3MDK A;  2IJY A;  1KTE A;  1AQW A;  1TTZ A;  2RM5 A;  2I9H A;  4EXJ A;  2X64 A;  1YKA A;  1M7T A;  3LYP A;  3P8W A;  3E0U A;  5DDL A;  5F8B A;  1Z5Y E;  5G30 A;  1AQX A;  3R3E A;  5B6N A;  4ECB A;  1OC8 A;  3HXS A;  2NDO A;  5LD0 A;  1A8Y A;  1O85 A;  3KZQ A;  2DJ1 A;  4DVC A;  1XWK A;  2OE1 A;  2F9S A;  5D9X A;  3KH7 A;  2HLS A;  4CDO A;  2ALB A;  2GQK A;  3TKQ A;  3ED3 A;  1M2B A;  1M3I A;  20GS A;  4F03 A;  3ZZX A;  1YF1 A;  3I9V 2;  4G2E A;  4HSC X;  5A4U A;  1XW9 A;  3L0H A;  1GWC A;  2PN8 A;  2DJK A;  1RQM A;  4N0V A;  5CRD A;  4GST A;  4XS6 A;  5DAL A;  4PUF C;  2K8S A;  3VWU A;  2EFE A;  1GTB A;  1YEP A;  3ISO A;  4E8H A;  2DML A;  2M72 A;  4ZB8 A;  3V1W A;  3GRX A;  3ERF A;  5D73 A;  4IHU A;  3EMP A;  3DWV A;  4K5S A;  2E7P A;  2L4C A;  2FUG 2;  2OA7 A;  1JLV A;  2PU9 C;  3D4T A;  1YEX A;  5KOX A;  5LNK e;  4I97 A;  5GSS A;  1GUM A;  1XVW A;  2FD3 A;  2LJA A;  3F3Q A;  3KIJ A;  4XHM A;  4HUA A;  3KJY A;  4ICY A;  3I6A A;  2HI7 A;  4GDF A;  4CY8 A;  3US3 A;  4XTS A;  4KDX A;  4HS1 A;  1MDJ A;  2H1D A;  2H71 A;  1ZCP A;  4F9Z A;  3ZIT A;  2WZS A;  3D4M A;  5ENU A;  3A2W A;  1QUW A;  5GAP D;  3CHX C;  4IVF A;  3RHB A;  7GSS A;  5BMU A;  4Z7X A;  1TKD B;  4O5Q A;  3VPT A;  3F6D A;  3P90 A;  1Y1U A;  3GUS A;  1GH2 A;  4MH2 A;  5IOW A;  4AKI A;  1SJZ A;  1XOA A;  2HXK A;  4PGT A;  4ML1 A;  4O5U A;  5CNW A;  3A2X A;  1MEK A;  1ZOF A;  3IV4 A;  1YZX A;  3UVT A;  2PUK C;  4IJ3 A;  2N5A A;  1QXH A;  3KD0 A;  4LLR A;  5D9W A;  5DCH A;  3RDW A;  1GTU A;  2JSY A;  3QD9 A;  4TXV A;  3MAK A;  2H0I A;  1FB6 A;  4DSR A;  1PN9 A;  1SD9 A;  1PKZ A;  2X4A A;  3W8S A;  1MD4 A;  1VF4 A;  3ZMK A;  5DVB A;  5H5R A;  3TJK A;  5HR3 A;  2VCV A;  1HQO A;  2G2Q A;  5KN2 A;  4ZL7 A;  4N10 A;  4AJ8 A;  4EDY A;  1XPV A;  4GWR A;  2RLI A;  1PRX A;  3UAR A;  5G31 A;  2HRF A;  2V32 A;  3G7I A;  2WRT A;  3M1G A;  1ZYE A;  1GSD A;  1WMJ A;  5F0G A;  4MH3 A;  1PSQ A;  4PI0 C;  3TDG A;  14GS A;  1F9M A;  2P0G A;  1S3C A;  2GZY A;  2DBC A;  4BA7 A;  2FNO A;  1SL1 B;  1GSE A;  1X5D A;  2HRA A;  2LQQ A;  4PTS A;  4JE1 A;  4GXZ A;  2FHE A;  2KLX A;  4Q5N A;  3LG6 A;  2IMF A;  1SKW B;  1TRS A;  1SYR A;  4TR3 A;  2VLV A;  2E0Q A;  4K7N A;  1EV9 A;  4K9Z A;  3VK9 A;  1R5A A;  3Q6O A;  4JBB A;  3VI5 A;  3BJ5 A;  1HNC A;  5L71 A;  1BF5 A;  5B7C A;  2OKA A;  2R0G A;  2C1Y A;  3PR8 A;  3KMN A;  1X9W B;  2CAQ A;  3ME8 A;  12GS A;  3EVI A;  1N2A A;  4Q5R A;  4K0N A;  3SWL A;  5GAN D;  3IR4 A;  4HQS A;  3F6F A;  3F8U A;  4ZB7 A;  5ELG A;  1EWX A;  3CSH A;  1U3A A;  2NVL A;  3TKS E;  3I69 A;  2WUL A;  5AIS A;  4N11 A;  2VL3 A;  4OO4 A;  3ERG A;  2OBK A;  5HR2 A;  2YWM A;  4OFM A;  4K2D A;  2WDU A;  1H75 A;  2B1L A;  4AJ6 A;  2FWE A;  3GKN A;  1XZO A;  2YWO A;  2O89 A;  5B8B A;  2GDR A;  2L5L A;  2VCT A;  2MMO A;  3F0I A;  3VUR A;  3M9J A;  2RUF A;  3HMJ G;  1XW6 A;  2H66 A;  4LA1 A;  2YWN A;  4IP6 A;  2MMZ A;  3F3R A;  2LRC A;  2YAN A;  2HSM B;  1X0R A;  3HZ8 A;  4ILF A;  3GL5 A;  11GS A;  3C1S A;  3E3E A;  3GX0 A;  2H74 A;  4A5P A;  4MPF A;  4XS4 B;  1S3D A;  2GS3 A;  4PNG A;  2TRC P;  5AGY A;  4ZIL A;  2DC5 A;  2FCH A;  1K0C A;  3ZRD A;  1K3Y A;  1K3O A;  2DJ2 A;  3IXR A;  4MK3 A;  3OR5 A;  3HZ4 A;  3DD3 A;  2WGR A;  3PGT A;  2LV3 A;  1EV4 A;  2UV8 G;  5ID2 B;  2GVP A;  4IKH A;  2AV4 A;  2HYX A;  2CVD A;  1FOH A;  4Z2U A;  4IGJ A;  4EKZ A;  5B8A A;  4BWS A;  5ECL B;  6GSV A;  2C0F A;  3MIX A;  1I1I P;  3HJM A;  2OAD A;  4TRX A;  1U87 A;  4TOP A;  1QQ2 A;  2YWI A;  4ZB9 A;  2LEG A;  1HD2 A;  4L0W A;  3N9J A;  3W8J A;  3F4S A;  2BTO T;  2JL4 A;  5HQP A;  2MYG A;  1PN0 A;  3IHQ A;  3AY8 A;  4HJ2 A;  1VF2 A;  4E8E A;  2LS5 A;  3F4T A;  3CSI A;  2KHP A;  1HNA A;  4YQM A;  2H70 A;  3QOU A;  1GNE A;  2H75 A;  1Y6E A;  3TJF A;  4MA9 A;  1M9A A;  4N0Z A;  1J08 A;  4O92 A;  1SVL A;  2R6K A;  4PQ1 A;  2VLU A;  3C8E A;  3HVS A;  5F06 A;  5J47 A;  2K6V A;  3LXZ A;  2DSA A;  4TW5 A;  2L4Q A;  2WVZ A;  1YY7 A;  5CO3 A;  4KF9 A;  3RPN A;  3DKS A;  3WGD A;  3ZIJ A;  1TK5 B;  1V98 A;  3KEB A;  3SBC A;  3HD5 A;  1ACV A;  3C73 A;  4DSQ A;  3A5W A;  3LW9 A;  5ECO B;  4YKG A;  2B6M A;  3TGZ A;  1CQH A;  3CTF A;  3D6I A;  1KBN A;  1YEW C;  2H1L A;  2A2R A;  3FZ4 A;  4IJI A;  3IK9 A;  4JZQ A;  3IOS A;  1I9D A;  3KCM A;  2XPD A;  5GST A;  1T1V A;  3A3T A;  4ZIJ A;  5J9B A;  2YP6 A;  2CAI A;  2EFC A;  2X49 A;  2K9F A;  5HFG A;  1BG1 A;  4MJA A;  4YKF A;  3DEX A;  2L5O A;  3TOU A;  1R5P A;  1N25 A;  2O8V B;  4MZB A;  4EDZ A;  5JCU A;  1AUC A;  3GSS A;  2X8H A;  1SVM A;  4E68 A;  2TIR A;  3FW2 A;  1E2Y A;  2IL3 A;  4GTU A;  4JR4 A;  3TCO A;  2NPB A;  3D0Z A;  1WJK A;  1B4P A;  1TU7 A;  2C3N A;  5FT3 A;  3LYK A;  1FB0 A;  2H76 A;  3ZTL A;  5IM9 A;  5GZZ B;  4V2M A;  1OAZ A;  4TN8 A;  2C3Q A;  1TXX A;  2LQO A;  2PPT A;  4ZL8 A;  5A5H B;  2KP1 A;  3LOR A;  3CRU A;  1Z3E A;  4ISD A;  3EIN A;  5ECM B;  5J40 A;  2EIO A;  3K8N A;  5J4U A;  2P5Q A;  3M3M A;  4BL7 B;  1PGT A;  5IPG A;  5A4V A;  6GSY A;  1TJD A;  3CWG A;  1TDI A;  4Q5Q A;  5DQY A;  3ZYW A;  2QKE A;  4LL4 B;  3DIE A;  4DEJ A;  1M9B A;  3KMO A;  2WCI A;  4F0B A;  1GLQ A;  4WBJ A;  5IIZ A;  4PI2 C;  1EGR A;  5JCG A;  3UJ1 A;  2VUP A;  2LRN A;  2HSM A;  3TRX A;  5CRE A;  2AYT A;  3MWH A;  2LNS A;  2IWT A;  4K2X A;  1PL2 A;  2CT6 A;  4I5Q A;  4IP1 A;  1YJ6 A;  2LKU A;  1G7E A;  4WEY A;  2YCD A;  1K0O A;  2JSZ A;  4XS4 A;  1Z6N A;  5IQY A;  4I8B A;  5IO0 A;  1THX A;  5HR0 A;  1XWA A;  2PBJ A;  3TOT A;  1GUH A;  1FVJ A;  1VGL A;  4N3Z A;  3IHG A;  4IN0 A;  2O3E A;  1SL2 B;  3G9B A;  2B1K A;  4OCE A;  3HKR A;  1V2A A;  5ID2 A;  2GT6 A;  1KNG A;  5DJM A;  1GL8 A;  5IMZ A;  3TKP A;  2VL9 A;  4HU7 A;  1NSW A;  3D22 A;  4POB A;  2YV7 A;  3U5R E;  1AQV A;  4KH7 A;  1SEN A;  2VOC A;  1ERW A;  5C00 A;  3C7M A;  2GTU A;  3ZVJ D;  2F3M A;  2BJX A;  4K7I A;  4V2L A;  2E2G A;  4KGI A;  2LJK A;  4PUR A;  3GFK A;  2IMD A;  2M46 A;  5AIX A;  2B5Y A;  4WBR D;  4ULX A;  18GS A;  2QSI A;  1AXD A;  9GSS A;  3GUR A;  1QGV A;  5DCG A;  3WGX A;  3HY2 A;  2V6K A;  3U6V A;  4FYC A;  1A0F A;  2C3T A;  2IMI A;  2JU5 A;  1OKD A;  1V40 A;  5ECI B;  3PH9 A;  1W89 A;  4IQ1 A;  4YQV A;  3M0F A;  5EVO A;  1ZYN A;  4Z2R A;  4KDU A;  6GSU A;  3TJJ A;  4WR5 A;  4GRF A;  2DLX A;  1S3R A;  1J0F A;  5ECH B;  2FLS A;  5KEJ A;  3NIV A;  2JZT A;  1GTA A;  4PHZ C;  2B5E A;  1BAY A;  5J5N A;  3Q19 A;  2VL2 C;  2R37 A;  1PFO A;  3DXB A;  4RUV A;  3FHK A;  1KEB A;  3CMI A;  4EL1 A;  4LMV A;  2K8V A;  1RW1 A;  1S4B P;  2K18 A;  4BWQ A;  1OKT A;  3TRQ A;  4QL9 A;  1WP0 A;  1GLP A;  3IAS 2;  4K0G A;  5J3R A;  4RQR A;  5DAK B;  3GH9 A;  3GN3 A;  4XCS A;  4O7H A;  4IQA A;  4G0I A;  2OE3 A;  3EYT A;  4X0X A;  2GZP A;  4W66 A;  4IEL A;  1TI1 A;  1WPI A;  4V2N A;  5G2Z A;  3QAV A;  5G5E A;  1O8W A;  4AF2 A;  1LJR A;  5HFI A;  5G5F A;  2VCZ A;  1DUG A;  4IS0 A;  1O6J A;  5A5K A;  5IMC A;  2DJJ A;  4DSS B;  2PMT A;  4POK A;  5KN3 A;  4USS A;  1ERU A;  1T3B A;  3IC8 A;  2HZE B;  3QAG A;  3FY7 A;  1GTI A;  4MCU A;  3IA1 A;  2YOI A;  2H6X A;  1WWJ A;  4PUA A;  3FMW A;  22GS A;  3O3T A;  2OBI A;  2V1M A;  4EF0 A;  1JFU A;  4WF5 A;  4JRR A;  3L9U A;  5A5H A;  6GSS A;  4F82 A;  5FHI A;  4H86 A;  2GLR A;  4AKX B;  2QGV A;  4JU5 A;  4F2I A;  4AJ7 A;  2DJ0 A;  4BL7 A;  2IPA A;  1PQN A;  4ECI A;  4XS1 A;  1ILO A;  1TRU A;  6GSX A;  5D93 A;  3GKX A;  2VO4 A;  5CP1 A;  1TXU A;  3WT1 A;  2HZF A;  4D73 B;  1JHB A;  2Z9S A;  1F3A A;  1ZL9 A;  3GKM A;  1R7H A;  2XC2 A;  2R0P A;  1GSS A;  5HFK A;  3GV1 A;  4KB3 A;  2C4J A;  1G0T A;  4NAX A;  5ECR B;  1NW2 A;  3ME7 A;  2DKH A;  4PQH A;  2H1B A;  2EFH A;  2V2G A;  2VIM A;  3QDN A;  4RQX A;  3GTU B;  5DQS A;  4G9H A;  4I2U A;  1HYU A;  1JZO A;  2YN1 A;  4HJM A;  2H1A A;  4J57 E;  3NOF A;  2UZ8 A;  2F8F A;  2KP2 A;  2FA4 A;  1GNW A;  3I43 A;  2LRT A;  3HVV A;  5CAX A;  2LJR A;  1N8J A;  3E9J B;  3O76 A;  4MJB A;  2HRN A;  2M80 A;  2AHE A;  2JZS A;  4HQZ A;  5AIV A;  1XVQ A;  5B6M A;  1YVL A;  3LJR A;  3FYG A;  4WR4 A;  4MF5 A;  1DE1 A;  4YAP A;  2HSY A;  5G1K A;  5ECK B;  3PIN A;  6GST A;  2YV9 A;  2EIQ A;  1PX7 A;  1EEM A;  2GZZ A;  1JLW A;  5JWO B;  2I81 A;  4BVY B;  1MTC A;  2LTK A;  3QMX A;  1URM A;  5FWG A;  2J9H A;  2C0G A;  1T4Y A;  2VCX A;  2H19 A;  1A8L A;  5IMA A;  1K3L A;  3FRC A;  1UN2 A;  2WFC A;  1OE7 A;  1XWB A;  2H6Z A;  2HSN B;  3MYD A;  2DIY A;  3MNG A;  5IMF A;  5HR1 A;  1OC9 B;  2J23 A;  3HVN A;  4YH2 A;  3QFA C;  4KA0 A;  2GSS A;  1OVN A;  4HZ4 A;  1XCC A;  2WVY A;  3QAW A;  3UVH A;  3TJB A;  3P7X A;  2RII A;  1XW5 A;  4CY6 A;  3VWX A;  5D9V A;  4IBP A;  3J7Y b;  1X5C A;  3UBK A;  1O81 A;  4EO3 A;  3IRA A;  4NPB A;  2YPM A;  2CA8 A;  3GX8 A;  1K0M A;  1R26 A;  3A5I A;  3JCM L;  4MJC A;  2VL2 A;  3VPQ A;  1C72 A;  1B8X A;  2PGT A;  1IYI A;  3H1N A;  2QA2 A;  3KP9 A;  4K5R A;  5DAK A;  2ZNM A;  1CQG A;  5IMV A;  3IAM 2;  1U6T A;  1UC7 A;  2MBS A;  5D96 A;  2R5G A;  4POL A;  3IE3 A;  3GL3 A;  2WW2 A;  1FHE A;  4KX4 A;  3LXT A;  2GQM A;  5COH A;  3WD6 A;  4CHS A;  2D2Z A;  4NMU A;  3WGE A;  2IN3 A;  2B3S A;  4F0C A;  2VD1 A;  1GUL A;  5E59 A;  1SJ6 A;  4OO5 A;  3C1R A;  2HNL A;  4NV2 A;  2H0G A;  3FK8 A;  4DSS A;  1SYX A;  2L57 A;  2WW3 A;  4HOJ A;  2VLT A;  1PL1 A;  1LBK A;  1XOB A;  4TKY A;  3GKK A;  2HZE A;  4TR1 B;  5ELA A;  1SKS B;  2XHF A;  3IDV A;  4WF4 A;  1V57 A;  4RI6 A;  3KXO A;  2X99 A;  1T00 A;  3H79 A;  1MDK A;  5CRH A;  1M3J A;  2MZC A;  2E2M A;  5BRT A;  2H6Y A;  4HDE A;  2BMX A;  4X1U A;  1ERV A;  1K0N A;  2NTO A;  3CYN A;  5CYY A;  2WW1 A;  2KOK A;  3Q18 A;  1ZZY A;  4EC0 A;  5IOX A;  3L9V A;  4KAE A;  4LL1 B;  4D73 A;  1GSU A;  4KE3 A;  5JCW A;  1F3B A;  1AIU A;  5IO2 A;  2GSR A;  2IME A;  1EP7 A;  2WS2 A;  4LMW A;  3GMF A;  2F51 A;  3R2Q A;  2GST A;  2XPE A;  4G10 A;  2B5X A;  2O5V A;  1J9B A;  3H4K A;  1ZYQ B;  4ECJ A;  3RBT A;  5IPH A;  2GSQ A;  2IFQ B;  3MSZ A;  3GTU A;  3ZRE A;  1SL0 B;  1I5G A;  4AI6 A;  5ECP B;  4GLT A;  2X8G A;  2A4H A;  4P3Y B;  2H8L A;  1A2J A;  4KDY A;  2B7J A;  3LEF A;  17GS A;  1JZR A;  2ZCT A;  2YZU A;  4Z2T A;  3J7Y k;  4FYB A;  2H73 A;  2HT9 A;  4J2F A;  3L4N A;  1B9X C;  3CXG A;  2FWF A;  1VF1 A;  1B9Y C;  5A1N B;  4GF0 A;  3FEU A;  4K8M A;  4MF7 A;  3TU3 B;  3QCP A;  4YAV A;  3RHC A;  2DJ3 A;  2HE3 A;  2C0D A;  1K0B A;  4QL7 A;  3KP8 A;  1G7O A;  1XWC A;  1YKC A;  1SD8 A;  4BVY A;  2CX4 A;  2RM6 A;  5JWR B;  1THO A;  5KOW A;  4OMV A;  1X5E A;  2QC7 A;  4I6X A;  2CQ9 A;  16GS A;  2AUV A;  2LUS A;  1M2D A;  3TKS C;  4ACS A;  4ZBB A;  3GA4 A;  4NXI A;  4GQF A;  1PKW A;  1FVK A;  3LFL A;  3DML A;  1QMV A;  1TRW A;  5G1L A;  1S3A A;  3KH9 A;  2HSN A;  1TI3 A;  2VM2 A;  3ZML A;  2R0C A;  1OC9 A;  1A23 A;  3G7Y A;  4L0U A;  3D21 A;  4GSS A;  1NHY A;  4AKH A;  1TU8 A;  4FYU A;  3HYP A;  2VM1 A;  5JWQ B;  3WT2 A;  3FR9 A;  2WVX B;  4NV5 A;  1M2A A;  3EU4 A;  1PMT A;  2JAD A;  3UMA A;  4KND A;  1Q4J A;  3M9K A;  1U88 A;  4ZB6 A;  2L59 A;  3TUE A;  3F4R A;  3UBL A;  3NZN A;  3DVX A;  1ERT A;  4GCI A;  1EOG A;  1BX9 A;  5DBQ A;  3M8N A;  2VCQ A;  1NM3 A;  3ERW A;  1V58 A;  5A34 B;  2IIY A;  3ZLP A;  5F07 A;  4WKW A;  1WOU A;  3IBH A;  5ECN B;  2OT3 A;  4OFT A;  4OCF A;  3W6G A;  1ZYP A;  2I1U A;  1FAA A;  2DMM A;  2DKI A;  4BVX B;  5H5S A;  3VWV A;  2B7K A;  4KW6 A;  4TVE A;  3GYK A;  3DRN A;  4CW9 A;  5ABR A;  4WET A;  1O8X A;  2H0H A;  2LNT A;  2TRX A;  2H01 A;  3KTB A;  3UL3 A;  1DBY A;  1TRV A;  1FO5 A;  1GRX A;  4ML6 A;  3LQ7 A;  5LCZ A;  1UA5 A;  3ZIV A;  2AB6 A;  1RK4 A;  4PQI A;  1GSY A;  2JZR A;  2HRK B;  3VI7 A;  5EY6 A;  2CZ3 A;  3D5J A;  4TR1 A;  3ZVJ A;  1SVO A;  3BD2 A;  1B48 A;  2OE0 A;  4TR4 A;  4KCA A;  1ML6 A;  4O32 A;  4Q5F A;  5KN1 A;  2A4V A;  3FZ9 A;  4HI7 A;  3KM6 A;  1T7P B;  3HCZ A;  4EVM A;  1SK1 A;  4MZC A;  2C80 A;  4QQ7 A;  4NWY A;  4EIP A;  1M99 A;  2I4A A;  4FQU A;  3BBY A;  19GS A;  4FH8 A;  5DJL A;  4J56 E;  2X8C A;  2WW0 A;  1A0R P;  3VWW A;  3CQF A;  3HA9 A;  4XIH A;  3H93 A;  4KUN A;  1A2L A;  4OD7 A;  1Y25 A;  4KSM A;  1BED A;  1Z7P A;  2JAC A;  1WE0 A;  1YF0 A;  4X4J A;  2R2J A;  4KCE A;  1O7U A;  1XG8 A;  2I3Y A;  2IFQ A;  4RI7 A;  2WZ9 A;  1QFN A;  5E4W A;  4MP4 A;  1X9M B;  2PVQ A;  4HEA 2;  2HQT A;  2CVK A;  2P31 A;  1QK8 A;  3GH6 A;  1YDK A;  3FR3 A;  2MMA A;  2WB9 A;  5J9C A;  3Q74 A;  1BG5 A;  2ON7 A;  4XRD A;  3C71 A;  5A1N A;  1DSB A;  4MLY A;  4AKG A;  1G6W A;  3A2V A;  3QFB C;  4NHZ A;  1ABA A;  1YQ1 A;  4FO5 A;  4PX1 A;  5EL8 A;  1FG4 A;  3KGK A;  4G01 A;  4MPG A;  3GIX A;  1XBS A;  4G19 A;  5EPF A;  2N5B A;  2PVO C;  3FZ5 A;  1WRY A; 
#chains in the Genus database with same CATH homology
 1LU4 A;  3FKF A;  4ZL9 A;  4MF6 A;  4K6X A;  2L6C A;  4OFN A;  3DGQ A;  1EEJ A;  4OWY A;  2CV4 A;  3EWL A;  4ID0 A;  4XRA A;  3RAZ A;  3ZL5 A;  2CX3 A;  1UVZ A;  1SU9 A;  2P5R A;  1SJI A;  3TKS A;  3H8Q A;  1USB A;  3EUR A;  4TXO B;  1HNB A;  3IPZ A;  4HZ2 A;  3RPP A;  2H1G A;  5AN1 A;  1PX6 A;  1T8E B;  4QMK A;  3HHV A;  4JED A;  3VFI A;  4X43 A;  3BCK A;  2NBS A;  3APQ A;  4N30 A;  1F2E A;  1GP1 A;  4YQU A;  3FZA A;  2O7K A;  3ZFB A;  1JZW A;  4EUY A;  1ZMA A;  3IK7 A;  4K7O A;  3UEM A;  1BQ7 A;  4AGS A;  4L5L A;  4G0L A;  3L78 A;  5A34 A;  2C8U A;  2DIZ A;  1F37 A;  1ZGN A;  1EP8 A;  1O73 A;  1ST9 A;  2A2P A;  1Z9H A;  1VF3 A;  3EE2 A;  2MBT A;  3IC4 A;  10GS A;  1TOF A;  4L8E A;  4NHW A;  4BVX A;  2EIR A;  5J4V A;  3GHA A;  4GQC A;  2OJL A;  5DAL B;  1MDI A;  8GSS A;  3QPM A;  1OC3 A;  3F63 A;  4EE0 A;  3PPU A;  4BPY A;  4ECC A;  1SKR B;  4FIW A;  3HJO A;  4O5R A;  2N5F A;  5CRG A;  2LST A;  1EZK A;  1Q98 A;  1IYH A;  2GT5 A;  1FW1 A;  3G7J A;  2A2S A;  3LGC A;  4L5O A;  2EC4 A;  1FOV A;  1G6Y A;  1OE8 A;  3EC3 A;  2R4V A;  3GNJ A;  4EIQ A;  2R3X A;  2O85 A;  2HRK A;  3VLN A;  2WJU A;  1R4W A;  4MJE A;  3O6T A;  2H30 A;  5J4Y A;  2GGT A;  13GS A;  2G0F A;  1B4Q A;  5CRW A;  2XBQ A;  1SK2 A;  2YJ7 A;  5D8I A;  1OYJ A;  4HU9 A;  4V1A g;  1TW9 A;  2HFD A;  4K1F A;  2FWG A;  4MMM A;  1E6B A;  3TJG A;  4PXO A;  5IMD A;  2CVB A;  4MDC A;  1PD2 1;  2H72 A;  2REM A;  1A2M A;  1JZD A;  2KUC A;  3EU3 A;  2ON5 A;  3UAP A;  2FY6 A;  2VKZ G;  2FGX A;  1M0U A;  2F8A A;  1VRS D;  2V41 A;  4MAB A;  3QR6 A;  3LWA A;  3HJP A;  1PA3 A;  1V9W A;  4MZW A;  5BMU B;  4ZBA A;  1NHO A;  1BJX A;  5A4W A;  1BYE A;  2VD0 A;  1AAZ A;  3FR6 A;  3BCI A;  3F9U A;  1H4O A;  2CZ2 A;  2YJH A;  1AC1 A;  1XWG A;  2VCW A;  4G0K A;  1W4V A;  1SK0 A;  3BOA A;  4POM A;  1XIY A;  1MD3 A;  3APO A;  3WYW A;  5J41 A;  2O87 A;  3EPT A;  1XXU A;  3TB2 A;  3LSZ A;  2AJQ B;  2FWH A;  2ES7 A;  1X9S B;  1ON4 A;  1K0A A;  2MMN A;  1GSQ A;  4PNF A;  4ZBD A;  1GSF A;  3DVW A;  3UOM A;  4IW9 A;  2VAF A;  3UIW A;  3HVX A;  2FA8 A;  2XBI A;  2PWJ A;  3CRT A;  2HSH A;  5D9T A;  1Z7R A;  2ZUP A;  1TK8 B;  5ECS A;  2YNX A;  3L9S A;  2QA1 A;  4KSO A;  1EOH A;  3EMX A;  1EGO A;  2IMK A;  3HDC A;  4TR0 A;  2AAW A;  2L6D A;  1K0D A;  3CTG A;  6GSW A;  1A24 A;  4I2T A;  2RUE A;  1Z6M A;  4MNN A;  3DYR A;  2YZH A;  5KN0 A;  2EFD A;  2PER A;  3KTL A;  3TRP A;  1DE2 A;  3CBU A;  4ZXG A;  1F6M C;  4V1A p;  5F05 A;  2V6O A;  3S9F A;  1T4Z A;  1GUK A;  1AW9 A;  3CSJ A;  3TKR A;  5C04 A;  3N5O A;  3APS A;  5ECQ B;  2C0E A;  2OAC A;  2GQL A;  3ZFL A;  1TP9 A;  3P2A A;  4GSN A;  1WIK A;  4TXO A;  1XFL A;  1U3I A;  4JR6 A;  3GST A;  5H5Q A;  1TK0 B;  4WXT A;  5INY A;  3MDK A;  2IJY A;  1KTE A;  1AQW A;  1TTZ A;  2RM5 A;  2I9H A;  4EXJ A;  2X64 A;  1YKA A;  1M7T A;  3LYP A;  3P8W A;  3E0U A;  5DDL A;  5F8B A;  1Z5Y E;  5G30 A;  1AQX A;  3R3E A;  5B6N A;  4ECB A;  1OC8 A;  3HXS A;  2NDO A;  5LD0 A;  1A8Y A;  1O85 A;  3KZQ A;  2DJ1 A;  4DVC A;  1XWK A;  2OE1 A;  2F9S A;  5D9X A;  3KH7 A;  2HLS A;  4CDO A;  2ALB A;  2GQK A;  3TKQ A;  3ED3 A;  1M2B A;  20GS A;  4F03 A;  3ZZX A;  1YF1 A;  3I9V 2;  4G2E A;  5A4U A;  1XW9 A;  3L0H A;  1GWC A;  2PN8 A;  2DJK A;  1RQM A;  4N0V A;  5CRD A;  4GST A;  4XS6 A;  5DAL A;  4PUF C;  2K8S A;  3VWU A;  2EFE A;  1GTB A;  1YEP A;  3ISO A;  4E8H A;  2DML A;  2M72 A;  4ZB8 A;  3V1W A;  3GRX A;  3ERF A;  5D73 A;  4IHU A;  3EMP A;  3DWV A;  4K5S A;  2E7P A;  2L4C A;  2FUG 2;  2OA7 A;  1JLV A;  2PU9 C;  3D4T A;  1YEX A;  5KOX A;  5LNK e;  4I97 A;  5GSS A;  1GUM A;  1XVW A;  2FD3 A;  2LJA A;  3F3Q A;  3KIJ A;  4XHM A;  4HUA A;  3KJY A;  4ICY A;  3I6A A;  2HI7 A;  4GDF A;  4CY8 A;  3US3 A;  4XTS A;  4KDX A;  4HS1 A;  1MDJ A;  2H1D A;  2H71 A;  1ZCP A;  4F9Z A;  3ZIT A;  3D4M A;  5ENU A;  3A2W A;  1QUW A;  5GAP D;  4IVF A;  3RHB A;  7GSS A;  5BMU A;  4Z7X A;  1TKD B;  4O5Q A;  3VPT A;  3F6D A;  3P90 A;  1Y1U A;  3GUS A;  1GH2 A;  4MH2 A;  5IOW A;  4AKI A;  1SJZ A;  1XOA A;  2HXK A;  4PGT A;  4ML1 A;  4O5U A;  5CNW A;  3A2X A;  1MEK A;  1ZOF A;  3IV4 A;  1YZX A;  3UVT A;  2PUK C;  4IJ3 A;  2N5A A;  1QXH A;  3KD0 A;  4LLR A;  5D9W A;  5DCH A;  3RDW A;  1GTU A;  2JSY A;  3QD9 A;  4TXV A;  3MAK A;  2H0I A;  1FB6 A;  4DSR A;  1PN9 A;  1SD9 A;  1PKZ A;  2X4A A;  3W8S A;  1MD4 A;  1VF4 A;  3ZMK A;  5DVB A;  5H5R A;  3TJK A;  5HR3 A;  2VCV A;  1HQO A;  2G2Q A;  5KN2 A;  4ZL7 A;  4N10 A;  4AJ8 A;  4EDY A;  1XPV A;  4GWR A;  2RLI A;  1PRX A;  3UAR A;  5G31 A;  2HRF A;  2V32 A;  3G7I A;  2WRT A;  3M1G A;  1ZYE A;  1GSD A;  1WMJ A;  5F0G A;  4MH3 A;  1PSQ A;  3TDG A;  14GS A;  1F9M A;  2P0G A;  1S3C A;  2GZY A;  2DBC A;  4BA7 A;  2FNO A;  1SL1 B;  1GSE A;  1X5D A;  2HRA A;  2LQQ A;  4PTS A;  4JE1 A;  4GXZ A;  2FHE A;  2KLX A;  4Q5N A;  3LG6 A;  2IMF A;  1SKW B;  1TRS A;  1SYR A;  4TR3 A;  2VLV A;  2E0Q A;  4K7N A;  1EV9 A;  4K9Z A;  3VK9 A;  1R5A A;  3Q6O A;  4JBB A;  3VI5 A;  3BJ5 A;  1HNC A;  5L71 A;  1BF5 A;  5B7C A;  2OKA A;  2R0G A;  2C1Y A;  3PR8 A;  3KMN A;  1X9W B;  2CAQ A;  3ME8 A;  12GS A;  3EVI A;  1N2A A;  4Q5R A;  4K0N A;  3SWL A;  5GAN D;  3IR4 A;  4HQS A;  3F6F A;  3F8U A;  4ZB7 A;  5ELG A;  1EWX A;  3CSH A;  1U3A A;  2NVL A;  3TKS E;  3I69 A;  2WUL A;  5AIS A;  4N11 A;  2VL3 A;  4OO4 A;  3ERG A;  2OBK A;  5HR2 A;  2YWM A;  4OFM A;  4K2D A;  2WDU A;  1H75 A;  2B1L A;  4AJ6 A;  2FWE A;  3GKN A;  1XZO A;  2YWO A;  2O89 A;  5B8B A;  2GDR A;  2L5L A;  2VCT A;  2MMO A;  3F0I A;  3VUR A;  3M9J A;  2RUF A;  3HMJ G;  1XW6 A;  2H66 A;  4LA1 A;  2YWN A;  4IP6 A;  2MMZ A;  3F3R A;  2LRC A;  2YAN A;  2HSM B;  1X0R A;  3HZ8 A;  4ILF A;  3GL5 A;  11GS A;  3C1S A;  3E3E A;  3GX0 A;  2H74 A;  4A5P A;  4MPF A;  4XS4 B;  1S3D A;  2GS3 A;  4PNG A;  2TRC P;  5AGY A;  4ZIL A;  2DC5 A;  2FCH A;  1K0C A;  3ZRD A;  1K3Y A;  1K3O A;  2DJ2 A;  3IXR A;  4MK3 A;  3OR5 A;  3HZ4 A;  3DD3 A;  2WGR A;  3PGT A;  2LV3 A;  1EV4 A;  2UV8 G;  5ID2 B;  2GVP A;  4IKH A;  2AV4 A;  2HYX A;  2CVD A;  1FOH A;  4Z2U A;  4IGJ A;  4EKZ A;  5B8A A;  4BWS A;  5ECL B;  6GSV A;  2C0F A;  3MIX A;  3HJM A;  2OAD A;  4TRX A;  1U87 A;  4TOP A;  1QQ2 A;  2YWI A;  4ZB9 A;  2LEG A;  1HD2 A;  4L0W A;  3N9J A;  3W8J A;  3F4S A;  2BTO T;  2JL4 A;  5HQP A;  2MYG A;  1PN0 A;  3IHQ A;  3AY8 A;  4HJ2 A;  1VF2 A;  4E8E A;  2LS5 A;  3F4T A;  3CSI A;  2KHP A;  1HNA A;  4YQM A;  2H70 A;  3QOU A;  1GNE A;  2H75 A;  1Y6E A;  3TJF A;  4MA9 A;  1M9A A;  4N0Z A;  1J08 A;  4O92 A;  1SVL A;  2R6K A;  4PQ1 A;  2VLU A;  3C8E A;  3HVS A;  5F06 A;  5J47 A;  2K6V A;  3LXZ A;  2DSA A;  4TW5 A;  2L4Q A;  1YY7 A;  5CO3 A;  4KF9 A;  3RPN A;  3DKS A;  3WGD A;  3ZIJ A;  1TK5 B;  1V98 A;  3KEB A;  3SBC A;  3HD5 A;  1ACV A;  3C73 A;  4DSQ A;  3A5W A;  3LW9 A;  5ECO B;  4YKG A;  2B6M A;  3TGZ A;  1CQH A;  3CTF A;  3D6I A;  1KBN A;  2H1L A;  2A2R A;  3FZ4 A;  4IJI A;  3IK9 A;  4JZQ A;  3IOS A;  1I9D A;  3KCM A;  2XPD A;  5GST A;  1T1V A;  3A3T A;  4ZIJ A;  5J9B A;  2YP6 A;  2CAI A;  2EFC A;  2X49 A;  2K9F A;  5HFG A;  1BG1 A;  4MJA A;  4YKF A;  3DEX A;  2L5O A;  3TOU A;  1R5P A;  1N25 A;  2O8V B;  4MZB A;  4EDZ A;  5JCU A;  1AUC A;  3GSS A;  2X8H A;  1SVM A;  4E68 A;  2TIR A;  3FW2 A;  1E2Y A;  2IL3 A;  4GTU A;  4JR4 A;  3TCO A;  2NPB A;  3D0Z A;  1WJK A;  1B4P A;  1TU7 A;  2C3N A;  5FT3 A;  3LYK A;  1FB0 A;  2H76 A;  3ZTL A;  5IM9 A;  5GZZ B;  4V2M A;  1OAZ A;  4TN8 A;  2C3Q A;  1TXX A;  2LQO A;  2PPT A;  4ZL8 A;  5A5H B;  2KP1 A;  3LOR A;  3CRU A;  1Z3E A;  4ISD A;  3EIN A;  5ECM B;  5J40 A;  2EIO A;  3K8N A;  5J4U A;  2P5Q A;  3M3M A;  4BL7 B;  1PGT A;  5IPG A;  5A4V A;  6GSY A;  1TJD A;  3CWG A;  1TDI A;  4Q5Q A;  5DQY A;  3ZYW A;  2QKE A;  4LL4 B;  3DIE A;  4DEJ A;  1M9B A;  3KMO A;  2WCI A;  4F0B A;  1GLQ A;  4WBJ A;  5IIZ A;  1EGR A;  5JCG A;  3UJ1 A;  2VUP A;  2LRN A;  2HSM A;  3TRX A;  5CRE A;  2AYT A;  3MWH A;  2LNS A;  2IWT A;  4K2X A;  1PL2 A;  2CT6 A;  4I5Q A;  4IP1 A;  1YJ6 A;  2LKU A;  1G7E A;  4WEY A;  2YCD A;  1K0O A;  2JSZ A;  4XS4 A;  1Z6N A;  5IQY A;  4I8B A;  5IO0 A;  1THX A;  5HR0 A;  1XWA A;  2PBJ A;  3TOT A;  1GUH A;  1FVJ A;  1VGL A;  4N3Z A;  3IHG A;  4IN0 A;  1SL2 B;  3G9B A;  2B1K A;  4OCE A;  3HKR A;  1V2A A;  5ID2 A;  2GT6 A;  1KNG A;  5DJM A;  1GL8 A;  5IMZ A;  3TKP A;  2VL9 A;  4HU7 A;  1NSW A;  3D22 A;  4POB A;  2YV7 A;  3U5R E;  1AQV A;  4KH7 A;  1SEN A;  2VOC A;  1ERW A;  5C00 A;  3C7M A;  2GTU A;  3ZVJ D;  2F3M A;  2BJX A;  4K7I A;  4V2L A;  2E2G A;  4KGI A;  2LJK A;  4PUR A;  3GFK A;  2IMD A;  2M46 A;  5AIX A;  2B5Y A;  4WBR D;  4ULX A;  18GS A;  2QSI A;  1AXD A;  9GSS A;  3GUR A;  1QGV A;  5DCG A;  3WGX A;  3HY2 A;  2V6K A;  3U6V A;  4FYC A;  1A0F A;  2C3T A;  2IMI A;  2JU5 A;  1OKD A;  1V40 A;  5ECI B;  3PH9 A;  1W89 A;  4IQ1 A;  4YQV A;  3M0F A;  5EVO A;  1ZYN A;  4Z2R A;  4KDU A;  6GSU A;  3TJJ A;  4WR5 A;  4GRF A;  2DLX A;  1J0F A;  5ECH B;  2FLS A;  5KEJ A;  3NIV A;  2JZT A;  1GTA A;  2B5E A;  1BAY A;  5J5N A;  3Q19 A;  2VL2 C;  2R37 A;  3DXB A;  4RUV A;  3FHK A;  1KEB A;  3CMI A;  4EL1 A;  4LMV A;  2K8V A;  1RW1 A;  2K18 A;  4BWQ A;  1OKT A;  3TRQ A;  4QL9 A;  1WP0 A;  1GLP A;  3IAS 2;  4K0G A;  5J3R A;  4RQR A;  5DAK B;  3GH9 A;  3GN3 A;  4XCS A;  4O7H A;  4IQA A;  4G0I A;  2OE3 A;  3EYT A;  4X0X A;  2GZP A;  4W66 A;  4IEL A;  1TI1 A;  1WPI A;  4V2N A;  5G2Z A;  3QAV A;  5G5E A;  1O8W A;  4AF2 A;  1LJR A;  5HFI A;  5G5F A;  2VCZ A;  1DUG A;  4IS0 A;  1O6J A;  5A5K A;  5IMC A;  2DJJ A;  4DSS B;  2PMT A;  4POK A;  5KN3 A;  4USS A;  1ERU A;  1T3B A;  3IC8 A;  2HZE B;  3QAG A;  3FY7 A;  1GTI A;  4MCU A;  3IA1 A;  2YOI A;  2H6X A;  1WWJ A;  4PUA A;  3FMW A;  22GS A;  3O3T A;  2OBI A;  2V1M A;  4EF0 A;  1JFU A;  4WF5 A;  4JRR A;  3L9U A;  5A5H A;  6GSS A;  4F82 A;  5FHI A;  4H86 A;  2GLR A;  4AKX B;  2QGV A;  4JU5 A;  4F2I A;  4AJ7 A;  2DJ0 A;  4BL7 A;  2IPA A;  1PQN A;  4ECI A;  4XS1 A;  1ILO A;  1TRU A;  6GSX A;  5D93 A;  3GKX A;  2VO4 A;  5CP1 A;  1TXU A;  3WT1 A;  2HZF A;  4D73 B;  1JHB A;  2Z9S A;  1F3A A;  1ZL9 A;  3GKM A;  1R7H A;  2XC2 A;  2R0P A;  1GSS A;  5HFK A;  3GV1 A;  4KB3 A;  2C4J A;  1G0T A;  4NAX A;  5ECR B;  1NW2 A;  3ME7 A;  2DKH A;  4PQH A;  2H1B A;  2EFH A;  2V2G A;  2VIM A;  3QDN A;  4RQX A;  3GTU B;  5DQS A;  4G9H A;  4I2U A;  1HYU A;  1JZO A;  2YN1 A;  4HJM A;  2H1A A;  4J57 E;  3NOF A;  2UZ8 A;  2F8F A;  2KP2 A;  2FA4 A;  1GNW A;  3I43 A;  2LRT A;  3HVV A;  5CAX A;  2LJR A;  1N8J A;  3E9J B;  3O76 A;  4MJB A;  2HRN A;  2M80 A;  2AHE A;  2JZS A;  4HQZ A;  5AIV A;  1XVQ A;  5B6M A;  1YVL A;  3LJR A;  3FYG A;  4WR4 A;  4MF5 A;  1DE1 A;  4YAP A;  2HSY A;  5G1K A;  5ECK B;  3PIN A;  6GST A;  2YV9 A;  2EIQ A;  1PX7 A;  1EEM A;  2GZZ A;  1JLW A;  5JWO B;  2I81 A;  4BVY B;  1MTC A;  2LTK A;  3QMX A;  1URM A;  5FWG A;  2J9H A;  2C0G A;  1T4Y A;  2VCX A;  2H19 A;  1A8L A;  5IMA A;  1K3L A;  3FRC A;  1UN2 A;  2WFC A;  1OE7 A;  1XWB A;  2H6Z A;  2HSN B;  3MYD A;  2DIY A;  3MNG A;  5IMF A;  5HR1 A;  1OC9 B;  2J23 A;  4YH2 A;  3QFA C;  4KA0 A;  2GSS A;  1OVN A;  4HZ4 A;  1XCC A;  3QAW A;  3UVH A;  3TJB A;  3P7X A;  2RII A;  1XW5 A;  4CY6 A;  3VWX A;  5D9V A;  4IBP A;  3J7Y b;  1X5C A;  3UBK A;  1O81 A;  4EO3 A;  3IRA A;  4NPB A;  2YPM A;  2CA8 A;  3GX8 A;  1K0M A;  1R26 A;  3A5I A;  3JCM L;  4MJC A;  2VL2 A;  3VPQ A;  1C72 A;  1B8X A;  2PGT A;  1IYI A;  3H1N A;  2QA2 A;  3KP9 A;  4K5R A;  5DAK A;  2ZNM A;  1CQG A;  5IMV A;  3IAM 2;  1U6T A;  1UC7 A;  2MBS A;  5D96 A;  2R5G A;  4POL A;  3IE3 A;  3GL3 A;  1FHE A;  4KX4 A;  3LXT A;  2GQM A;  5COH A;  3WD6 A;  4CHS A;  2D2Z A;  4NMU A;  3WGE A;  2IN3 A;  2B3S A;  4F0C A;  2VD1 A;  1GUL A;  5E59 A;  1SJ6 A;  4OO5 A;  3C1R A;  2HNL A;  4NV2 A;  2H0G A;  3FK8 A;  4DSS A;  1SYX A;  2L57 A;  4HOJ A;  2VLT A;  1PL1 A;  1LBK A;  1XOB A;  4TKY A;  3GKK A;  2HZE A;  4TR1 B;  5ELA A;  1SKS B;  2XHF A;  3IDV A;  4WF4 A;  1V57 A;  4RI6 A;  3KXO A;  2X99 A;  1T00 A;  3H79 A;  1MDK A;  5CRH A;  2MZC A;  2E2M A;  5BRT A;  2H6Y A;  4HDE A;  2BMX A;  4X1U A;  1ERV A;  1K0N A;  2NTO A;  3CYN A;  5CYY A;  2KOK A;  3Q18 A;  1ZZY A;  4EC0 A;  5IOX A;  3L9V A;  4KAE A;  4LL1 B;  4D73 A;  1GSU A;  4KE3 A;  5JCW A;  1F3B A;  1AIU A;  5IO2 A;  2GSR A;  2IME A;  1EP7 A;  2WS2 A;  4LMW A;  3GMF A;  2F51 A;  3R2Q A;  2GST A;  2XPE A;  4G10 A;  2B5X A;  2O5V A;  1J9B A;  3H4K A;  1ZYQ B;  4ECJ A;  3RBT A;  5IPH A;  2GSQ A;  2IFQ B;  3MSZ A;  3GTU A;  3ZRE A;  1SL0 B;  1I5G A;  4AI6 A;  5ECP B;  4GLT A;  2X8G A;  2A4H A;  4P3Y B;  2H8L A;  1A2J A;  4KDY A;  2B7J A;  3LEF A;  17GS A;  1JZR A;  2ZCT A;  2YZU A;  4Z2T A;  3J7Y k;  4FYB A;  2H73 A;  2HT9 A;  4J2F A;  3L4N A;  1B9X C;  3CXG A;  2FWF A;  1VF1 A;  1B9Y C;  5A1N B;  4GF0 A;  3FEU A;  4K8M A;  4MF7 A;  3TU3 B;  3QCP A;  4YAV A;  3RHC A;  2DJ3 A;  2HE3 A;  2C0D A;  1K0B A;  4QL7 A;  3KP8 A;  1G7O A;  1XWC A;  1YKC A;  1SD8 A;  4BVY A;  2CX4 A;  2RM6 A;  5JWR B;  1THO A;  5KOW A;  4OMV A;  1X5E A;  2QC7 A;  4I6X A;  2CQ9 A;  16GS A;  2AUV A;  2LUS A;  1M2D A;  3TKS C;  4ACS A;  4ZBB A;  3GA4 A;  4NXI A;  4GQF A;  1PKW A;  1FVK A;  3LFL A;  3DML A;  1QMV A;  1TRW A;  5G1L A;  1S3A A;  3KH9 A;  2HSN A;  1TI3 A;  2VM2 A;  3ZML A;  2R0C A;  1OC9 A;  1A23 A;  3G7Y A;  4L0U A;  3D21 A;  4GSS A;  1NHY A;  4AKH A;  1TU8 A;  4FYU A;  3HYP A;  2VM1 A;  5JWQ B;  3WT2 A;  3FR9 A;  4NV5 A;  1M2A A;  3EU4 A;  1PMT A;  2JAD A;  3UMA A;  4KND A;  1Q4J A;  3M9K A;  1U88 A;  4ZB6 A;  2L59 A;  3TUE A;  3F4R A;  3UBL A;  3NZN A;  3DVX A;  1ERT A;  4GCI A;  1EOG A;  1BX9 A;  5DBQ A;  3M8N A;  2VCQ A;  1NM3 A;  3ERW A;  1V58 A;  5A34 B;  2IIY A;  3ZLP A;  5F07 A;  4WKW A;  1WOU A;  3IBH A;  5ECN B;  2OT3 A;  4OFT A;  4OCF A;  3W6G A;  1ZYP A;  2I1U A;  1FAA A;  2DMM A;  2DKI A;  4BVX B;  5H5S A;  3VWV A;  2B7K A;  4KW6 A;  4TVE A;  3GYK A;  3DRN A;  4CW9 A;  5ABR A;  4WET A;  1O8X A;  2H0H A;  2LNT A;  2TRX A;  2H01 A;  3KTB A;  3UL3 A;  1DBY A;  1TRV A;  1FO5 A;  1GRX A;  4ML6 A;  3LQ7 A;  5LCZ A;  1UA5 A;  3ZIV A;  2AB6 A;  1RK4 A;  4PQI A;  1GSY A;  2JZR A;  2HRK B;  3VI7 A;  5EY6 A;  2CZ3 A;  3D5J A;  4TR1 A;  3ZVJ A;  1SVO A;  3BD2 A;  1B48 A;  2OE0 A;  4TR4 A;  4KCA A;  1ML6 A;  4O32 A;  4Q5F A;  5KN1 A;  2A4V A;  3FZ9 A;  4HI7 A;  3KM6 A;  1T7P B;  3HCZ A;  4EVM A;  1SK1 A;  4MZC A;  2C80 A;  4QQ7 A;  4NWY A;  4EIP A;  1M99 A;  2I4A A;  4FQU A;  3BBY A;  19GS A;  4FH8 A;  5DJL A;  4J56 E;  2X8C A;  1A0R P;  3VWW A;  3HA9 A;  4XIH A;  3H93 A;  4KUN A;  1A2L A;  4OD7 A;  1Y25 A;  4KSM A;  1BED A;  1Z7P A;  2JAC A;  1WE0 A;  1YF0 A;  4X4J A;  2R2J A;  4KCE A;  1O7U A;  2I3Y A;  2IFQ A;  4RI7 A;  2WZ9 A;  1QFN A;  5E4W A;  4MP4 A;  1X9M B;  2PVQ A;  4HEA 2;  2HQT A;  2CVK A;  2P31 A;  1QK8 A;  3GH6 A;  1YDK A;  3FR3 A;  2MMA A;  2WB9 A;  5J9C A;  3Q74 A;  1BG5 A;  2ON7 A;  4XRD A;  3C71 A;  5A1N A;  1DSB A;  4MLY A;  4AKG A;  1G6W A;  3A2V A;  3QFB C;  4NHZ A;  1ABA A;  1YQ1 A;  4FO5 A;  4PX1 A;  5EL8 A;  1FG4 A;  3KGK A;  4G01 A;  4MPG A;  3GIX A;  1XBS A;  4G19 A;  5EPF A;  2N5B A;  2PVO C;  3FZ5 A;  1WRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...