6PCYA

Crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport protein(cuproprotein)
molecule keywords PLASTOCYANIN
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1986-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 6pcyA00
3SBRA 1AZRA 1SF5A 1UATA 1XB8A 2GC4C 3AG1B 3NP3A 5I26A 8PAZA 1JZHA 1N70A 2WSDA 4TXVB 3WG7B 2NRDA 5B1BB 3ZBMA 4W1TA 5TK2A 3SBPA 3FT0A 1NWPA 5B7FA 1XB6A 2BW4A 1L9PA 1JZEA 2A3TA 3DIVA 2DV6A 3QQXA 3FYEB 4G7QB 1BAWA 1SDDB 1BQRA 2PPFA 3FU7A 1TEGA 2H47C 2HRGA 3FSZA 5B7EA 1CC3A 1W6LA 1I53A 3X1FA 1IUZA 2X87A 5B1JA 1BEXA 3BVDB 4HIPA 3TU6A 1GY1A 3WIAA 3AG3B 1E65A 2PCFA 1OV8A 2ZXWB 3OQRA 4NERA 1WA1X 3S3DB 4BK5C 4KNUA 1GSKA 3TBCA 1WA2X 4YSQA 1X9UA 4M4RB 3AZUA 1M56B 2FQDA 5I6PA 2BP8A 2XXFA 3S3BB 2YAHA 1AS8A 1KYAA 2OCCB 1OCCB 4HAKA 1WS7A 1AZNA 2OJ1A 3MBWB 2UXFA 4AX3A 3OD3A 1EHKB 1BXAA 3UAAA 2WO2B 2BWDA 3NJGA 4DP1X 5B1KA 1OE2A 3NJFA 1OE3A 1SDDA 4A2HA 1PF3A 1IKOP 3KW7A 1J5DA 1VLXA 3CG8A 2IAAC 1BYOA 3NSCA 4HCFA 6PCYA 4G72B 6PAZA 1NZRA 3ABLB 1J9SA 3X1BA 2XVBA 3ABGA 4Q89A 2AZAA 3GDCA 4UANA 1NDTA 1JXDA 2IH9A 2H5UA 2YARA 4BWTA 7PCYA 2P80A 2PPAA 1NPNA 2CJ3A 1IC0A 5AZUA 2W88A 1T5KA 2YXVA 3PAZA 1OE1A 3FU9A 3N55A 1MZZA 1E30A 1ET7A 2JFCA 3AY2A 4G7RB 4HCGA 2FT6A 1PCSA 1RZPA 4CSZA 2HX8A 4AKPA 4WKXA 1ASPA 1FWXA 1JZJA 3WI9A 5I6LA 4P5SA 3UACA 1KDIA 2E86A 3IBOA 2VW4A 3JT2A 3SBQA 2I7OA 3UGEA 1RCYA 2PPEA 2IDTA 3NJLA 1AACA 4YSOA 1ET5A 4YSAA 2BZ7A 1J5CA 5I28A 3FSWA 5I5IA 1NINA 2VM3A 4DP8X 1M57B 3QJVB 4KO6A 2ZONA 1AS7A 2J56A 1ZPUA 4KOCA 2YQBA 2HZHA 1OCZB 2VMJA 2CBPA 2MRYA 3IN0A 1V54B 2EINB 4BXVA 2AFNA 3OMIB 2DYRB 5B1JC 1WAEA 3T6VA 2N0MA 2FQFA 3TBBA 4A68A 1ILUA 2XLLA 1FA4A 1CYXA 4M3HA 1KCWA 4G7SB 1CUOA 2BP0A 2GB2A 2UXGA 3WNJA 4L0PB 1AZCA 3QJQB 4FAAB 4JHVA 1TKWA 1BXUA 2VM4A 4HCIA 1NIBA 1HFUA 3NJJA 1A4BA 5F7AA 4EF3A 1CYWA 3SQRA 2W8CA 1PLAA 2PP7A 4E9SA 4KNSA 1ASOA 3L45A 4KO5A 2QT6A 4AKOA 2QDWA 1OOWA 2ZWNA 4GP4B 1AAJA 1RZQA 2J5WA 3WKQA 1E5ZA 7PAZA 3NJHA 2BP8B 2JXMA 1SFHA 5AKRA 3FSVA 4HALA 5B1AB 3FYIB 3T6XA 4DP7X 1KCBA 1ASQA 4A2EA 2BW5A 2BZCA 1ILSA 2HX9A 3H4FA 1BXVA 1MDAA 1V55B 2P80D 3NSYA 4DPBX 1KGYE 3FQ2A 2FQEA 3WNIA 4Q8BA 1JXFA 1JERA 3C75A 3ABKB 2ZOOA 2IWFA 1URIA 2XWZA 5FC9A 3PXLA 4DP4X 2XX0A 1OCRB 3ASNB 4PCYA 1KBWA 1TEFA 2I7SA 3IN2A 4X4KA 2DWTA 4N8UA 3UAEA 3T6WA 2CALA 3QJUB 4BXSV 1JVOA 3T6ZA 4E9XA 5PAZA 1A3ZA 2BWIA 2IDQA 1GY2A 3NT0A 2BP0B 3BQVA 1IBYA 4GY4A 3PCYA 2DYSB 4KOBA 5I6NA 3EH3B 2TSAA 3FQYA 2IDFA 1E5YA 4NAJA 4A2GA 1J9QA 1AIZA 1SFDA 1OF0A 1A8ZA 1GW0A 5I5MA 3S3CB 2YAMA 1NPJA 2PP9A 3EF4A 2QPEB 3DKHA 2UX6A 2AZUA 4F2EA 2YAOA 2FJSA 1AOZA 2FT8A 5D4IA 4ENZA 1ID2A 2J55A 2CAKA 1EZLA 2DY2A 2GSMB 5I6KA 4YSSA 1J9RA 3ERXA 1L9QA 2PPCA 5E9NA 4YSEA 1GYCA 3OMNB 2EIKB 3NJMA 4F2FA 4GP5B 4N4YB 3NJNA 1CURA 4E9TA 3D12B 1IBZA 3RYMA 3FPYA 1WA0X 4E9RA 2FQGA 2XUWA 1SJMA 1PNCA 2IH8A 4E9VA 1SF3A 1L9TA 3H56A 4HHGA 3AG4B 4YSPA 1YLBB 5I6MA 3NYKA 5I5JA 2GI0A 1ETJA 3ZX1A 1JZFA 1WS8A 2XV0A 4JKNA 1RKRA 4UAHA 1W8EA 2HRHA 2YAEA 4BDVB 1AQ8A 4YSCA 4G71B 4GXFA 4HZ1A 4GP8B 1L9OA 2I85A 2JKWA 1ZIAA 2RACA 5B7MA 3QJSB 1GR7A 4E9YA 2EILB 3KW8A 3HB3B 3NSFA 3QJTB 4A66A 4DPAX 1XMEB 4KNTA 4F7KA 1X9RA 1B3IA 1HAWA 3NJIA 2XXGA 4KO7A 1PAZA 2EIJB 1V10A 2DWSA 3FQ1A 1GS8A 2EIMB 3TA4D 3CVBA 3U25A 1QLEB 1JOIA 2BHFA 3UABA 1BQ5A 4A2DA 5I6OA 1KV7A 3AW5A 2PCYA 4NB7A 3CZUB 5IY5B 2J57A 1NIAA 5F7BA 1ADWA 1XB3A 1PZBA 1HAUA 1MG3C 1PMYA 4AKQA 2UX7A 4GYBA 5AFAA 4YL4A 1PY0A 5D4HA 3OMAB 4W9ZA 1ET8A 1A4AA 3PLYA 4BDVA 2WO3B 2MTAA 1JZGA 2FWLB 3H4HA 3IEAA 2CCWA 1FFTB 1SNRA 4DP9X 1N68A 2HX7A 1BYPA 1DZ0A 4UF7C 3CDZA 3EHBB 4P5RA 3TASA 4A67A 1ZDSA 1PZAA 2XYBA 1TU2A 3T71A 3ZIYA 1QNIA 1PNDA 2Y1AA 4FA7B 1PLBA 1SHXA 3AG2B 5ANHA 5LDUA 4G70B 3PAUA 1L9RA 3FU7B 1BQKA 2GIMA 4PAZA 1OCOB 3CVCA 4AZUA 1SHWA 4DP0X 1AG6A 2PP8A 3NP4A 1R1CA 2BO0A 1AZBA 1M9WA 3GYRA 2FT7A 3EH4B 1AANA 1NWOA 3V9EA 3GXUB 2YAQA 5D4JA 2AVFA 3QJRB 2X88A 4DP5X 4DP2X 3G5WA 1AZUA 2H3XC 3CDZB 4BWUA 1JVLA 2R7EB 4YSRA 5A7EA 4ZK8A 3ABMB 2GC7C 2OV0A 2QPDB 4A2FA 4E9WA 4WTQA 3DTUB 1PZCA 4YSTA 3QPKA 3T9WA 2GBAA 4YVUA 1W6WA 3V9CA 5PCYA 1AS6A 2UXTA 4BWWA 2IWKA 1ZV2A 4DP6X 4AI7A 2CUAA 2LLNA 5TK4A 4YSUA 1GS7A 1KBVA 1JZIA 1NTDA 2GHZA 2VN3A 1GS6X 1AR1B 3PAVA 4JHUA 3NSDA 2B08A 3ZDWA 2VW6A 1PLCA 1KDJA 2XX1A 4DPCX 2B3IA 2XU9A 5B3SB 3S8GB 2XV3A 1JXGA 3WKPA 3ASOB 2VW7A 4KO9A 4QKTA 3X1NA 1DYZA 2HXAA 1ZIBA 2PPDA 2AANA 2Y69B 2HLEB 2TSBA 2VSKB 3EH5B 1NIEA 3FS9A 3IE9A 2UXVA 9PCYA 2R7EA 1MG2C 1NIFA 2IWEA 4RH4A 3CVDA 1NIDA 2YAPA 2IDUA 2IDSA 1E67A 3UADA 2VSMB 4E9QA 4CSPA 1MZYA 2FTAA 3X1GA 2XV2A 2PLTA 2YAFA 2YXWA 1F56A 3FU8A 1NICA 5EHFA 3MX0B 3HEIB 4YVNA 3JTBA 2Q5BA 3PPSA 4QLWA 1J9TA 1A4CA 1ZDQA 3FSAA 3FPXA 3OM3B 3X1EA 3X2QB 1AG0A 1A65A 4HHWA 4YSDA 2FNWA 2Q9OA 4MFHA 1L9SA 2QDVA 3S8FB 3N2JA 3NJKA 1QHQA 4K9JA
chains in the Genus database with same CATH superfamily
4U3XA 4JQVC 2EZ0C 5J4MA 1E9QA 1TQTA 2GC4C 3K72B 4YQXL 5I26A 2NX5E 1ACCA 1SEBB 4J8QA 3P4NA 4QLRA 1QWNA 3TYGH 2VAJA 2PR4L 4X98A 1PZDA 1XH3A 3Q8FA 3UGUA 1BZEA 3OAYK 4NSKB 1TYJA 4GIAA 3L3KA 2NZ9C 3U9PL 2WBWB 5A7BA 2AQPA 4WWNA 4YXKH 1RK1B 4LSRH 1CF8H 3WEBA 5DHVB 5L4JA 1QACA 1JZDC 1KXVA 1XGYH 2RGSA 1NGXA 4WU5B 3FQWB 3MRLB 3LKQB 2E7CA 2BVQB 3UAJD 2CLZB 1SUJA 4MYPA 4PREB 1USZA 2GTZB 3BW9A 4ODWA 4FXGB 4YXKL 4ORGA 3OL2A 5LWYH 1DJYA 2W60A 3VRIA 1JTTA 3FW6A 1FIEA 3BVDB 4Q4EA 4I13B 4IBSA 4UV4L 2AEIT 2V2XB 4HULB 4L1DA 1OLLA 3KAAA 4R5VA 3H9ZA 5FYKE 3X11B 2Y07L 3ZSSA 1H5BC 1YMHB 4U6TA 5KS9F 4ZQKA 1RPKA 4G8GD 5CEZH 4IIZA 4KNUA 4JCWA 3L7FB 3PP4H 2BMKA 1CXFA 1F4WL 1E9QB 3K72A 4PJ8D 2D3NA 3BKYH 1E28A 4M4RB 4EKJA 4XMUA 4OLZL 1NKGA 1HZHH 4HUXA 4KMQA 5FO2A 3ZQWA 2ZYHA 4ZSOB 3IFNH 4MXVE 5JIKA 2AXFB 1TYEB 2P5EE 1JNLH 3TZVD 5JXED 2OJ1A 2YGVA 1E8WA 1Q72H 3VXMD 1IAKB 3CDCA 1FYTD 1JF1B 1SYVA 3ZZLA 3KEDA 4FHBD 4MMZB 1TJGL 1D7FA 3KLAA 1O0VA 3T77B 4AQ8A 1X5JA 4AGLA 2F8XC 1P2CA 1EDHA 4AJVA 2VIRA 4JFPB 1TJXA 4XN2A 4YDLC 4NJAH 3BDXA 3HCVA 4PCTA 3CFMA 1RZKH 3ROLA 4UANA 3ZT5A 1Z9PA 4XMKL 2IH9A 2LU5A 3ZTNH 5D2LF 5DUBA 2VDKL 5DRZB 2X4UA 4UV4H 5J13B 5I1GH 5AZUA 3EFFA 1HJCA 1KCVH 3P9MA 4H8UA 4CU6A 4HA1A 2WYZA 1E30A 3RVWC 4WCYL 3CFTA 3VXQB 1JI1A 1E8YA 3DBXB 3Q6GL 1CICC 5T1JA 4JFZH 1BVLA 1YNLH 4WK0B 1TLMA 5DRNA 5CFHA 4EI5B 3BP6A 4PYHA 1UFGA 4Q6IC 5C0IA 1I8MA 1WEJH 1RCYA 3KDMB 5FYLD 2RH0A 1Z7JA 5DMIH 3ZL2A 1JZ7A 4IK6A 4TPRL 4X9HA 1T2JA 3ULVL 1GTFA 1L3WA 4RZKA 3LZQA 1BVKA 4NJ9H 3IDYB 1MQKH 2O4EA 4AMKH 1NC2D 3BSGA 4JM2B 3QDGD 4BXVA 4JLRA 4NT6B 3UTPD 3S6CA 2BPBA 3I6GA 3L3OB 4BSWA 1WAEA 2AXGA 4RDQG 4XOAA 4DGUA 2GSIA 2ITDA 4UQDA 1VFAB 3UYPB 4Y5YC 5DTFB 4S0HA 1I7RB 1VEMA 2Y1VA 3LS5L 5AZEH 1HIMH 1T20B 4NC0B 1KC5H 1NC4D 5HVGB 3BEVB 1T0MB 2N7AA 4FXKA 4IRZH 4LNVA 4NIYE 1BXUA 1S9YA 2VM4A 4PJCE 4AGMA 4FTVE 1HFUA 1FNGB 4W9EC 3MLYH 1DN2A 4NBYB 4PRIE 5C08D 2BOBA 5TDPA 1IC4L 5DEGB 4JY5H 3ZW3A 4D9RD 4WQOA 1Q1JH 4Z7NF 2X12A 3B9AA 4PJFA 3QHZL 3GXFA 4LEOB 4WI5A 5I0ZA 1RHFA 4Y16A 3VACA 3GLEA 4XNUL 1E6OL 3LN4A 3WN5C 1H19A 3NJHA 3H3PL 1U8IA 1X5LA 2VO8A 1WCBA 4KKAC 4DO4A 1JV2A 4YHOL 5B1AB 2VZUA 5I19L 2OMZB 4GAGH 2XTJD 3D85D 5KVEL 4U49A 3HFML 1RZ8A 3KPOA 4P2OA 1MFDL 3JWNC 2F58L 1KIPA 1PFOA 2P80D 3K1DA 1R3JB 4PRHB 4DPBX 2FB4H 3D0LB 15C8H 1JERA 4ZXBD 5AOMA 2ZOOA 4LEBA 2XHNA 4MD5A 5GGRA 4G9FA 3BIKB 5I17A 1DO5A 4D0CB 4BCXA 2G0KA 4W6YB 5F8RC 3D52A 1X5KA 4DTGH 3MV7D 4HIHA 1KBWA 1YMMD 2I7SA 3N44F 3OLGA 5D7JA 4NRZB 1X7TA 2NY1B 2UWEE 5JLZA 3AUWB 1II4E 2NCMA 2Q6WB 4J1UA 4N8VB 1J1PL 3EOBA 5MENB 3LRKA 4TUKL 1AKJB 4I3SH 1NCCH 1KUMA 1OAZL 2EIZA 2F53A 1N7ML 1RY7B 2E76C 3C6LC 2B5IC 1J9QA 4CGUB 1AIZA 5K9OA 3IVKB 3S88L 4G7VL 3ALXA 5GGRY 1DQJA 3B9DA 4UOQA 3OHXA 2O6EA 1QFPA 2NR6A 4AW7A 2YJQA 4RZCA 4F2EA 1TVHA 1QSFB 3BGFC 4G43A 2WXKA 4Q0XL 5ECGA 3OZKA 2VLJE 1DUZA 4J3VA 3ULVD 2CKBA 1Y1DA 3GBMH 1KXHA 3GHEL 4OLYL 1EZLA 2GSMB 3E0GA 3CQQA 4XN7A 3SDDB 2L0DA 4R2GD 1BD2B 2XQBH 5HJDA 3AB0B 3S37H 5HHOE 2PKDA 4P2RA 5E8PB 4X99B 4QRRB 3UJJH 3FUFA 1T4WA 3U1SL 4PRAB 4UTCA 4H26B 3ZE0F 1DDHA 3HKZA 2AK4A 5D7JB 5C09B 5F9JB 4RGOH 1O75A 3GPSA 4LHQB 2GAZB 1MDTA 1G7QB 1I8AA 4YSPA 3S3PA 4GKZA 3FCSA 2J88H 4PGEA 3PWPA 2SEBB 3CLFL 5EDXA 3QO1A 3ZX1A 2KMWA 4PJ5A 1W15A 3ETTA 3G5XA 2ICWI 4PJBA 4H0LC 2IPTH 4L3ED 5CP7A 1IEAB 2VDQL 2YD8A 1F3RB 3DX7A 5GS0C 2VLKE 5CZXD 4ENED 2ZG3A 4QJ4B 4K2UL 3CU7A 1IX2A 1BZQK 1LO5B 1TZHA 5DC2A 3SD2A 2EILB 3ZKSD 1ZLWH 1KN4L 2ZKHL 2YUZA 4DPAX 2ILLA 3IDUA 1FFNB 1TZGL 5E2UL 3K46A 3TO4A 4N8CH 2C9UA 2HP4A 1UOWA 2CLRB 5MENE 1JGEB 3MDJA 4JO3H 1BQSA 1N3NB 2BHFA 4PJFB 3V0EA 3WY4A 4A37A 2DEXX 1DTUA 2BRRL 5TDPB 1DFXA 4KK8D 1N0XL 2APXA 3B9KD 2N7BA 1S9YB 1DBBL 1E42A 5HJ3B 2EEBA 5CKGA 3RY6C 5CHNB 1CGTA 5BRPA 3C5ZB 4UT6H 4Y4FB 4LBAA 1I8IB 3PP4L 2V6HA 3F7YB 4U1JA 2KDGA 1BPVA 1PYWB 2VABB 1ET8A 3L7EB 3R4RA 5EU6D 2KLSA 4U33A 3O2DH 4Z7NB 1RIVH 3PNRB 3W11C 1BZ7A 1FN4B 2C26A 4R5XA 4DP9X 3QULA 5ICXA 3RKDD 2X4QB 3ZTCC 4NQEA 4FG0A 2XIDA 2WGNB 2GABA 2XYBA 4R4BB 3WO3B 2J4WH 2XWEA 1D6VH 2HFTA 3BKYL 1X6LA 3PWJA 4FA7B 5CEXB 2CO7B 4ZJ9A 3REVB 5LDUA 3AWFA 4LK4A 4N8VA 3CZSA 5MENA 2BVOB 5BO0D 5AL0A 1ZK5A 3LEVL 1EUTA 4XTRD 3LOWA 4PLJD 4WNQB 3F84A 5D1QB 5JXAH 3D0VA 4IJ3C 4QRTA 4NNPH 1CBVH 4PWIA 1U33A 2HWZH 3IFLH 3BE1L 1WUZA 1KG0A 5IFHL 3MRDA 3D06A 4WFEE 5GISL 4PS8A 4X5PA 1JUFB 4CMHC 5BS0A 5D7SH 3F7LA 3RI5F 4P07A 2GBVA 5I1DA 3V4VL 5B39B 2ODIA 4DVBA 4KZEH 2FE0A 1NCUA 1AZUA 5F1IA 5ALCL 2R7EB 5A7EA 1AGEB 3UL4A 4GUCA 3DV4A 4MJ6A 2GSGB 4PYGA 3L4UA 4AE0A 3VFPB 3QPKA 1B0GA 2LOEA 1IJ9A 2D3VA 4DKEH 3SDXB 2QMKA 5T8IA 2R0ZL 4JW3A 2NNFA 2QGBA 4LIQE 4EIZC 5KBKA 4IRSC 1A6WH 3HZVA 3KGTA 2CUAA 3ISWA 4LEOA 4AQEA 3T1FB 1CD1B 2GHZA 4CDGC 4EN3C 3RGVC 1AR1B 3WTTA 5DEGA 2RR3A 4E41B 3GQFA 4QNPE 2YXFA 2NY5L 2DICA 1JF1A 3IETA 4Z3TA 4Z3FA 1T0MA 4FXKB 4PBDA 3ASOB 4U6VL 5IFAH 2DWEA 4LAQH 3SE9H 1T0OA 1OAKH 1NOLA 2YA0A 3MKGA 3WJLC 5C71A 1RIUL 3VH8G 5JQ6H 1X5ZA 2FATH 1EZUA 3IDMB 1GGIL 3BFOA 3HE6C 1GGTA 3H7LA 4I2XB 5FX3A 3TNNB 5ISZE 5C8JA 5FOBB 3LIZH 3D07A 4ZX6A 4OF8A 1EHNA 2EUVA 5AW3B 4JPVH 4WCYH 1NCOA 3QR1A 4LHUD 4OFKA 2JXMB 1CFTA 2G60L 3BD3A 1J8HB 2I9LA 4YHYC 3RWHA 5GZND 2HVBA 4HPYL 4YBLC 3BD4A 3FAWA 3N5AA 2VSMB 3V7MA 4TUJB 5A2FA 5AVRB 2QQKH 1GHFH 4EJ1C 1HH9B 2J5LB 2PLTA 1LP9A 3ARGD 4FQLH 4IKLA 4TQPA 4PJAB 5ICUA 3FB5A 3SOBH 3ZDZE 3FO9B 5FDWB 2VL4A 4Y2NA 1RLBA 1F42A 5E1AA 3BP6B 4LOFA 1YN6A 3CBJB 1YY8B 1PJ9A 4HHWA 3LEYL 1D5ZB 1OAXH 4MNQE 3S4SB 3CFDB 5T1MB 2QADC 3HBGA 3F7KA 3G5ZB 3HZMA 4F7CB 2L7QA 3KLDA 5D6CB 5LXVA 3WGUB 4NUGL 5AL8A 5F7HA 2DAVA 5DZOA 1FCCA 2FGWL 3SDDC 1U8QB 3UZEA 3NQIA 3R06B 4JFHD 4PVNA 3ROLB 5IHBA 3TNMA 1ND0B 2F61A 3EZ8A 1FVEB 5D7HA 1FVCA 4RFNC 3VFOB 3NGBC 3QIUC 4YLBA 2HFGL 1OSZA 4B41A 3L9BA 3WO4B 3TV3H 1BZ8A 1B2WH 2WWKT 4LEXL 2GITA 3K6DA 1MFMA 4NM8L 3DWTA 4Y2OB 5JPMB 1NSNH 4Y4HD 2QQLL 5EC1B 2BNUB 4BFEA 2CIKA 3MV9B 2IH1A 1FNLA 1BEXA 5F0JB 4LEXH 3CDFA 3VD5A 1W0YT 2WKLA 3UYRL 3KS0J 2OI9B 3L3GB 3QUHA 1ZA3A 3O41A 4LIQL 5ETUB 3GBML 1A7NL 3GHEH 4IKIA 4F33B 1Z5LB 1NC4B 1H6FA 2WYIA 4BQCA 2JVUA 3V0JA 5LN8A 3EAKA 2LU4A 3S3DB 1J11A 3IWUA 1MFUA 4MJIB 4OCLC 5E9DE 1KTLA 5F7KC 3AY4A 1J5IA 4ZTPL 4XHJC 1TQCB 3KPRB 2YHGA 4GRWF 3PG2A 1R47A 3MRMA 4XXWA 3MROB 1KTDB 4MJ4A 1AQDB 4C47A 1UB6A 2A6KB 3LN9A 4HAFA 4CVWA 2VN7A 1YPZF 4FOMA 4P5TB 5D2NA 4J28A 5C0DB 5IBTH 5DO2C 4XPHL 1CL7L 3LKQA 5DD6A 3TX4A 4GQRA 1OE3A 4U4BA 1UKQA 5CF3A 3HB3C 2G2RA 2UYLB 5EZJA 3DARA 3MYJA 1SJEA 3CFCL 3OXSB 1WVZA 5I8OH 3T5WA 2DQJH 5DC4B 5DQ9A 5F96H 4P4KD 5J12B 4TNWK 4DK6A 3ZKNC 3GDCA 1AGCA 4WO0A 5D71L 5C07B 3KPNB 4PJ5D 3P4NB 2X4OA 3X14B 2ZWLT 3QIBD 3LKPA 5TDNA 1HSBB 3K3QA 5E8EA 5FDYA 4I18B 3ULVE 1W72A 1KLFB 4UTAA 5A40E 4TQEH 5ESQB 3MA9L 3GZQA 4LIQH 5A2KH 4HCRA 4RETB 1VB9A 3HN8A 1OXYA 3MMEB 4Y5YB 1IAIL 3D50A 3K1KC 3AY2A 1ET7A 2JFCA 3DXAA 3SGKA 3AM8C 1XH0A 1VZIA 4KU1A 3O4LB 3DTXA 4DESA 3MLVL 2NZ9D 2QKIA 4K3DL 2E27H 3S3JA 2G9HB 4FI7A 5IB3B 2DDQL 2R29L 4XN1A 3UO1H 3ARGB 4DJMA 1KDIA 2X7LB 3H7BB 4K15A 4KQ3H 5FGSA 2OTPA 2N1TE 3HMXA 3FRPG 2GTWA 2IDTA 2V9TA 2YC1A 1TG8A 3MJ7A 1YNLL 3BPLC 4ZUUA 3S88H 2R9HC 3FH7A 3HJEA 5LBVA 2GHWB 2NW3A 4NQTA 1OGAD 4BQBA 3BT2L 4KO6A 4CU7A 2BRRH 2B4CH 3DMMD 2YQBA 5EUOF 5T1LA 2VMJA 2ZG2A 3CLWA 2JJWA 3ARGC 4ELKB 4H0IA 4XMPH 4CRPA 1EAPA 4L2LA 4L3EB 4F7PB 4G2AA 3W9DA 2JE8A 5IB1B 1ETZB 3P2TA 4RISH 3MLZL 4O02L 2XN9A 4ECNA 5EO9B 3EOTH 3GO1L 1SJVA 5E6IC 1BZDA 4AG4H 1THCA 3QI9D 4H8HA 4H88H 5HPMB 4JKPH 3T0XA 4AITA 4GRMB 1DSWA 2ICEB 1NEZA 4WZ9A 4OFQA 5A43C 2Q8AH 3MO1A 3VRJB 2ADJA 2YLHA 2C3VA 4H5SA 1BMZA 1NDGA 3QZBA 3DDGA 1A14L 4FYSA 4LARL 4ERSH 1TZOA 4OT1H 4X6CF 4GW5B 1B4TA 1BF2A 1YEKL 2YPLE 2GYSA 1SLUA 1RERA 2QT6A 2FL5A 3L45A 1EDYA 5B8CB 4JFYA 4BZ1H 3QUYD 3EO0A 5D1XD 4NUQA 3W1ZA 4OAWA 2XN9E 1HEZA 3DK2A 2AJZB 2OTUB 4PY7B 3HG1B 5IR1A 2BP8B 3KWWA 5EZLA 1MF2L 1I85C 4LSVL 3T6XA 4PIBA 4F8PA 5EU6E 4XAWL 4PMFA 1IE4A 3FSOA 3K81A 1QZNA 4L37A 2VDOB 5HYSA 4NO0A 3K4AA 4ELKA 3INOA 3X12B 1YUHB 3FQ2A 3GI9H 4M5ZH 3K0WA 2C7UB 3POHA 4WKZA 4YIQB 4GT7A 5F0MB 5I73C 3IDNA 2JCWA 4PVMA 2PYED 1VFMA 2FX7L 2H6OA 1CFMA 1OP9A 3MJ7B 4M5YH 1KMGA 4LLUA 4N8UA 4AQ1C 4OF3A 3EBAA 3HN5A 2VLLB 2ZAIA 3KLSA 2X1WL 3ATBA 3RKPA 3EFOA 4PJXF 4MMXC 1AJ7L 1E5YA 2OLDA 1Z2KA 1AO7A 4NAJA 1SFDA 1OF0A 3EG9A 1GW0A 5CZVL 1UWFA 1JCVA 3UADA 1E90A 3OC8A 3RVUD 2QPEB 2BH0A 1Z66A 2H45A 3NQKA 4F93B 2UX6A 1W72B 1KPUB 5T5FA 2EP6A 3V0VB 3LKPB 2X4OB 4KDWA 2AXHA 2HAZA 1ID2A 4AIOA 1AGCB 2NMSA 3OWRA 3W3BA 2CO1A 2GJRA 1A6AA 4FEIA 3AMLA 1BSIA 3KPSA 4K73A 5E9NA 5EUKA 4YPGB 1OP3H 2XZCH 3SOBL 2VLJB 2OXGA 3DBSA 1J86A 1NFIA 4PB0L 3OF6A 3BESR 2VLRA 5C08B 5BMFH 4XX1G 5EF1A 5D2NE 12E8L 2FX8L 3U2IA 3FPYA 3KXFB 4RMBA 1RFDL 4OD2A 5D8JL 4IEFB 2EC8A 3ESOA 3U7AA 4PRDA 1C5DA 3KYKH 3M1OA 3MA7B 3EH2A 4JFWA 2WXLA 3EBIA 3P11L 1VHPA 1U91A 2YPLD 1IILE 2EIBA 1OAJA 4HEPA 4PWGA 3KPRA 3HNSH 1ES0A 1QTYT 3VSUA 1GSMA 2EIDA 4MJIA 2YD4A 1EEYA 1QX1A 3E9UA 3PPEA 1L9OA 3BGMA 3ZYJA 3L1FA 1PG7L 3HS8A 2QV4A 5LGHH 3CX5J 1VPOL 3REWB 1A6TB 4M93C 5CN1A 4QTHA 1SN2A 3SO3C 4F33A 3C5SB 4MNGA 4HKBA 3I3EA 4FFYA 4N2BA 2FHCA 5FA3A 4MMZC 3L3GA 3RWIA 3K71A 5CD3B 5F97E 1NPUA 4HS6A 3WD5L 1OVZA 4NNXA 4LRNL 1BEYL 4JMNA 2IMNA 1S8DB 4XN5A 2J73A 4A6YH 2YJLA 4DW2H 2A2QT 3MV11 4UDUA 4V11A 4GW1B 4WWID 2PYFA 4RSYA 1NIAA 3SDCB 4H7VA 2DQCL 3MFGB 3ABZA 4CJ1A 3UTQB 5LKNA 1HAUA 1LWJA 5I9QC 4PV9B 1PU0A 4FQXD 1AR1C 3RGVB 3UTTA 2BNRA 4HJTA 5AFAA 5J56B 2BDNH 4LLVB 2A4ZA 3EUDA 1KFAH 4HK0B 4ZNCD 2LV4A 5DVNA 4PRBA 1IAOA 5FCSH 1F5WA 3GRWA 1OF2A 5C09E 2DWYA 4J27A 4HUKB 4G80A 2DQGH 2ZYSA 2RMNA 4S1RL 3GMRA 3H4HA 2BDNL 2CCWA 3C8KB 3IJEA 3QIBB 1SNRA 4HWEH 3TJEL 4QJ3B 4OLEA 3QQ4A 5E6ZA 2DEWX 2FWUA 3SKNA 4F7CA 3JVGA 4BFJA 1F1AA 3N1MC 3WXWL 3IDJB 4MNQA 4YBHA 4Z7VB 1FBIH 4DQAA 2PXYA 4JZNB 3LKOB 3HBZA 1S7SB 3T2LA 3JV4A 4R9HA 4OT1L 1ZWIB 1EK3A 1YAZA 4MMXA 1WT5C 3ZHLA 4NFDA 2KL6A 1GMEA 2WBJC 4ZUWA 3VD7A 1WBZA 1NGQH 1Q94A 3APNA 3NEEA 3T08A 1IIKA 1S4IA 3CK0H 3PIQB 1NBQA 1BJ1J 2PO6A 3GXIA 1XF3A 2YAQA 1S7SA 2FGWH 2TAAA 3V52L 1V7NH 4FQXC 1G0XA 3N04A 4JG9A 4U3SB 4Z7WF 5GRJH 3IGUA 5C0NC 4KITB 3RWHB 3PWPD 4EI6B 1DJSA 1MNUH 1QPXA 1KLUA 3V6FA 4BZ1A 3A6BH 3NH7H 2WPGA 4F57H 4N2NA 3WD5H 4U7SA 2JKIS 4A2FA 4E9WA 3PABB 4WTQA 1WZMA 1LK3L 1T66D 3LS4L 5IVOA 3MLWH 4PW4A 3P9LB 1TPXC 1KEGL 2MKLC 5BRZA 4PRBB 1QI3A 2FIKB 4Z7UF 4YHKL 1ZV2A 1CI5A 4MBOA 3SGDH 4P59L 3UTTB 1W80A 3IPBA 1NCBL 1NJ9B 3B2UD 2YPLB 1YPZE 4ODVH 1UB5A 2R23A 1RH8A 1UM6L 4UDUB 3MJ9A 5GSVA 3ILPB 1C5CH 3N1PC 1FNEB 4I4WB 2R29H 4DPCX 4PGDA 2ZX5A 1WAPA 1XH2A 2IPKB 3K6OA 3T1FA 2XIIA 1KPVA 1RZFL 3GKWH 4AIEA 4QRPB 1IBFA 5CEZL 4GPVA 4AC4A 1UZ6F 1MI5A 25C8H 4ZS7L 1WBXA 3L16A 4XXCC 3RIAK 1WGVA 1J0KA 3U7WL 4A7GA 1JFHA 2Y69B 3I75A 3WIFB 1A6TA 1KCVL 5I66B 1LO3L 2H6UA 4R7LA 2IADA 3L4WA 4PJ7E 3TO2B 1FIGL 3ZT6A 9PCYA 2HLFD 2R7EA 4NFCA 1NIFA 2I60H 1YEJH 2IXQA 5CEYA 3SDAB 1SVCP 3MGTA 2IDSA 3FHQA 3WELA 2J8HA 3E9TA 1SEQL 4M3JA 1IGIL 3TBVB 3MOBL 5TFSL 3ZPDA 1BBJA 2IGTA 3FQ4A 1DLHB 3JV5A 3JYCA 3P0VL 3RVVC 2R0KL 3VI3E 4TOYH 5C0FB 3PUUA 5HDQH 1G9MC 5T3XD 4KKBD 4OFYD 5GGQL 4KVNL 4XB7A 3PPSA 4OD2B 3VXRB 1W72H 1HCZA 1A4CA 1C5BH 1ZK9A 1KNOB 3WAKA 4NZUH 4JRXB 1CFVL 1CGXA 3ARQA 4GW4A 1OHZA 4AJ0A 4FQ1L 4KI1A 4ONOA 2HPOA 2E8YA 1J05A 3QG7H 4NQEB 1AY1H 1KFGA 4L4TE 3NDZE 3GMPA 5ICXB 1LL1A 2EVJA 4CGTA 2VL5B 1XCWA 4PJEA 5GRVK 1P5VB 3QFJB 4JX0A 3MC0A 3HPLB 2ZD0A 4XNXH 5EO0B 2ICES 2WIIA 4WNSA 4FNPA 5GS3A 1URZA 3KJ4B 3ZBMA 3O6ML 2RFXA 4MD0A 4F37F 3BVUA 5HHXL 2OR9L 1J1OL 5CINH 2J6EA 2JKTM 1U8PA 5I23A 1XB6A 4UQ3A 1QBBA 3AACA 3EF7A 4BSVA 3DIVA 3LHAA 1KIRB 2R69L 1CLOH 3WFHA 2VDOH 3LNHA 1IGFL 4X4XA 5GIRB 4NO2A 3VFSA 1UOLA 3HS0C 3HRZB 3TV3L 1CC3A 1IEBB 3D25A 2YEQA 2AQ2A 3BUYA 5IGXL 3FRUB 4JQVA 5SWZD 2JB6B 3EKCA 3UXFA 5FFOA 3J7HA 3AG3B 1Q4NX 3TBYA 1DJZA 1MH5B 2I07B 5ID0B 4U1KA 4WAFA 2MOVA 4OB5L 3S9DB 2NOYA 3OXRB 3D9AH 1JWMA 1UD8A 3BH8B 4M8UA 3CHPA 3DTDA 4JPIB 2EACA 3L95A 2ADGB 4B6ZA 4ETQA 1M56B 1ORQB 2SEBA 2XWBA 3MAWA 4ZD3H 5GJTL 4OJFH 4YFLI 4JREB 1CFVH 5IZ7A 3WFZA 3GI8L 3IU3A 3C08L 3H85A 4GQPH 3WNOA 1T22B 5GGVH 3OR7B 3ZDYF 2OX5A 3WIHL 4X7SH 1ZVYA 2BWDA 1EJOL 3MNZA 3NJGA 1G9NC 5EU6A 3SD5A 5HHNA 3WN5B 1M2VA 3DX6A 4PWFA 2IAND 3NJFA 4MDRA 5FWQA 4OV6F 2BWQA 3SO3B 2J71A 4JVWA 3K0YA 3PP3H 1QRNE 1VLXA 3TA3B 5ALBH 2L3BA 3QDJA 4JG0H 6PCYA 4P4KB 1V8HA 1BD2A 1NZRA 1R5VA 2X4RB 1J9SA 5KVEH 3PXHA 4AIZB 1CLZH 2QHRL 4CILA 1UJ3B 3THMH 1XH1A 1KGCE 5H94B 4DIXA 7PCYA 4RZCB 3NPSB 4OGAD 5IB1A 2YD0A 3BUDA 1S6NA 3TGXA 2NY3D 1W9XA 4NQCA 5C0CB 2FBJH 3V4VH 3FU9A 3B2VH 3Q8CA 5BJTB 1G5AA 5CAYB 2YOAA 1Q1JL 2HJFA 4TQEL 3KBEA 1YC8A 2NQ3A 4AEHH 4HUVA 1YO4A 3GPEA 5TF0A 4X80H 1CF1A 2WZAA 3Q2CA 4ZDHB 2XBDA 1MHHB 2C3GA 4QYOA 2HMID 1TO4A 1WWAX 2DI9A 2W9DH 4Z7UE 4C57C 1HNYA 4KROC 5I74C 3CFEB 1YNTA 1JWSB 1U6AH 4KKQA 4FXTA 5JQIB 1FZKB 1NINA 4L8DB 4R8WL 1EV2E 3MRNA 2MJWA 1E4KC 2FX9H 3QCTH 4Z7WB 1EZVX 3OPZH 3BEWB 3D0LA 2Y7LA 4EI5C 1PZ5B 4CVXB 4IBUA 1S9VB 3Q05A 1S9XA 3JSSA 1KBBA 1TSHA 1F2QA 3JTTB 3F2LA 2CDGB 3C6LB 3RX7A 3LH8A 2W07B 4OFDA 2NXYD 3OKDA 1HQRA 5EIIB 2BP5M 1HSBA 1JV2B 1WCBB 2SODB 1ILUA 1QFWL 2K6YA 2AKRA 1AQKL 4M3HA 3LN4B 3S34H 5F3HA 5IEHB 1MY7A 1FZOA 3HC3H 4FNLL 2CZNA 5ABAA 1DDTA 4LLAA 1LMKA 2Q10A 1ZJAA 2YA2A 5DJ2B 3WTWA 4JHVA 5EOCJ 3V79C 1XL4A 1B9ZA 4AV5A 1WDAA 2AJSH 2W8CA 3V0GA 3F12A 3E6FB 4V1DA 2PP7A 4PJBF 3ZR6A 2VDMB 1MWAL 3TA3C 4JL1A 2V8LA 5SWZE 1OHQA 2DDQH 4I89A 2Z65C 1AAJA 4Z3HA 2EYSA 1KCRH 4ZX4A 4WWKC 1RP8A 3ZZSA 4PJIB 4HWEL 1FL5A 3P3YA 1ETB1 3AU1A 5ADPH 1PAMA 2MNJB 1H9DA 1AD0A 1YMMA 3B5TA 4PJ5E 4X8CA 3UBGA 3PUCA 1A7QL 2HX9A 1T89C 1WIOA 4LSQL 1D7CA 3BAYA 4G59C 4NT6A 1MDAA 4CL7A 2J88L 4QYAA 1KY7A 3OMZA 1KCLA 1JPGB 5EBLA 4LQFH 1BIIA 4Q8BA 1C5CL 3HR6A 1G9EA 3SDAD 1V27A 1AGBB 4NKMB 3O41B 4QTIH 2WY3B 1XF4A 5J11C 3LH2L 3QEGH 1I1AD 4J6IA 4NCC2 5CIPH 3P77B 3PHQB 4WUUA 2OKMA 4P59H 1JG9A 4F8OA 1ACZA 1UYWH 4LPVA 1S9WB 3KCPA 5BUPA 5I1KH 4LCUB 4PI0A 4LLDB 1GY2A 2YRLA 1CTOA 2DYSB 2ZWYA 1BW8A 4GFTB 2TSAA 5FKPB 3FDWA 4OKDA 3QVAA 3OKKB 4ZFGH 4KWUA 1M4KA 4JZOA 4F8TA 1FVEA 3F64A 3MLSH 2YGPA 3PHOB 3HS9A 3NG5A 3DKHA 5LGKA 1JD9A 2D7MA 3SGEI 3QIUB 4LZKA 3BO8B 4ENZA 1I9RH 1FNHA 1NBCA 1E2ZA 4WO4D 1NDMB 1E7VA 1VFBB 3QXAB 4RIRB 4FKHA 3S5ZA 5D6CA 1F4XL 3I2CL 3OKEB 2Y9RT 2ZWKA 4JFPA 4OW6A 4PGCB 1LLAA 1Z0MA 3I6LD 3CDGA 2JTYA 4MD4B 3NZHH 1QBLL 5IKCB 4LLDA 1BMWA 1FJ1A 2EH7L 5F3BA 1NAML 2WTRA 5GGSB 4MNQD 3BDBA 4MMZA 2X6MA 4PV8A 1VKXA 2EXWD 3TF4A 2COQA 2IANA 3IYLW 2IMMA 1KGXA 4KQ3L 1PVHA 4XCEA 5F89B 4KJYA 5KVEE 1SF3A 2DKSA 2DLIA 1IGYA 1MXDA 3H56A 2FBRA 4OZ4B 1ETJA 3V0AC 3O6MH 3IGLA 5KSBB 1A5FH 3FK3A 1A02N 4KKBC 4HJSA 1E43A 5D7EA 3UTTD 3CQFA 3FUIA 1EMTH 4OIIL 3Q2WA 4UAHA 2IBZX 3IJYA 4N0UA 2CLVA 3MLUH 4LDOB 1TYRA 5B7MA 4ABUA 2MQ0A 4QRFA 5D7SL 1QKZL 4DGVH 5KYUB 4GG6F 3UC0L 1FHNA 1HI6A 3CXDH 2XQ0A 1GKEA 2LR4A 4F7KA 3GRWL 4NHUA 2DQHL 2XXGA 4KX7A 2BINA 2VERA 1QFUL 2AQNA 4JFTA 4R83A 3LPFA 1ONQB 2ZTBA 1RSFA 1A9VA 2Q3ZA 3EOYG 2VLKD 1KTCA 4UTBA 1QTSA 2CM6A 4H88L 3V6OA 2K3TA 1UH2A 3E6FA 4FL4C 4U1GB 1H3VA 1C1EH 3MUY1 3T0DA 3D4ZA 4OR1A 5JMOC 1LXMA 1IQDB 3GSWA 4F7TB 5HPOA 1U36A 4GYBA 1FF5A 4PJDA 1E7UA 2I60L 2ICCA 4EN3B 1RFDH 3O9WC 3OVUB 4HDIB 3CQPA 1WFJA 4BDVA 1QEXA 2WO3B 3KPQB 5EOCL 3LQZA 3OKDB 1TXKA 2GJ6A 3IRZA 4IS6A 4AMKL 1BYPA 4HIXH 3TFBA 3QEUA 1U41A 1PZAA 3JT0A 4CADA 3AREC 5I1AA 3DIFB 1WT5A 3FXIC 3PWNA 1ECZA 4LDEB 3PF2A 4EUPA 3VUAA 1OB1B 4FFZL 4UMSA 5HHQB 4OZGE 2CXGA 4XBGA 1Q0EA 3CC5B 2VM9A 1H3WM 1U8LB 3RX9A 1ZHNA 1N59A 2JF1A 4PJFF 3CIQA 3G6JE 1AG6A 2GJZB 3NP4A 4N2LA 3VNYA 2FT7A 3QJHB 3MODH 1T1ZB 2CPUA 2WBJA 4D0DB 3KJ4C 5ID1B 5LJYH 3HRPA 4O2FA 3HNTL 4D9LH 3MLXL 3QJRB 5AVTB 3PWJB 4QGTA 4B97A 4GRLD 5FV2A 3AAZB 4K23H 4AOFA 3MOAL 3C60C 4DGVL 3SY0A 1CE6B 2XRAL 3RGBA 4CN4A 1HWGB 2HTKD 3QUXB 4APQC 2YQ3A 3LNEA 3VXOB 3FT1A 3AXLA 3L5XH 4OV5B 1XGTB 1ZHKA 4FTDA 2JJSC 3AREB 4M5TA 1EHXA 1PW3A 3Q1SL 4YSTA 1MNUL 1N26A 5DJZA 4JN1L 4DERA 1Z3GH 4YVUA 3QNYB 3L7EA 4M6OH 4JRLA 1MLBA 1U93B 1WRFA 4Y4FA 4PJDF 3V6OC 2WLHA 4LP5A 4QRAA 2ATAA 4XPHH 2IVFC 3HE7C 4M6NL 1UT9A 3CWGA 2ARJQ 1LEIB 1EX0A 1JNNL 1A7BA 2R39A 4YX2H 1GYAA 3P4LA 4HKZB 3SCMD 1OLZA 3OJDA 3SKJH 2FWOB 2DIBA 4LCIH 2VW6A 4FKKA 5B3SB 2O5XH 3DHPA 4HC1A 1JXGA 1P84J 1TKWB 1KPRB 2O5ZH 3GWJA 3BZ4A 1ODUA 1TZIA 1DVXA 1UQSB 1YEDA 3BJLA 1AXSA 3NPZB 4JFFE 4OF5A 4OM1L 4H0HB 4WWKD 1JZ4A 2NY0B 2G60H 2ZXBA 2NQDA 1QBML 3QARA 3BN9C 2VXSL 2PW1B 2K70A 4G6FD 2A6JA 3BUTA 1ROWA 5KSAB 3ZE1E 2J1ZA 3KPLA 5CGTA 5KS9E 1HHKB 1VERA 1AH1A 1DVTA 2JKSA 1NIDA 2EDDA 3PREA 3S3SA 3BWUF 1TCMA 4QEGA 3WEXB 4MRCA 4PJGB 3QWQB 2GT9B 3WNKA 1ED3B 4AE1A 4JO4H 1AD9B 5KBLA 3MGAA 1JXKA 1SM3H 1F56A 4FEMA 4PRID 2XKUA 1MWAH 3FCUB 4MS6A 4W9LC 3WFBL 3QEQB 5EHFA 3R19A 1A1NB 4ADGA 1IRAY 1Q8MA 3SGKC 5A3IC 2HKFH 1XEUA 3QDMA 1UCBL 4FFVD 4PRAA 4J23A 3D3VA 3X1EA 1NC2B 1Q0XH 4LT7A 3ZMRA 5E8PA 1JK9A 3LRMA 1A3LH 3U7YL 1AC6A 4KX8A 4WUKL 2NT0A 2J1YA 3NFPB 5C2BH 3OAZK 1BWWA 1DJWA 1VADB 1ZSHA 1H8NA 2J3SA 3ETSA 1KN4H 2APVA 4JN2B 4NQDE 3AG1B 4EO5A 1PBYA 2NXZD 5LXGH 2CO2A 1QSFA 4LPCA 1PS3A 25C8L 3U7WH 2DB8A 3K2UH 2VL5A 4OCWH 4OZFB 3BP4A 3IFPB 1UXMA 1ZS8A 1NWPA 3GEFA 2WJ7A 3HFMH 4I1RA 5CN2A 3RWCB 4MSWA 3H0TB 3ELAT 3K2IA 2A3TA 3FCBA 4LF3A 4WJG3 5G5DB 4A7UA 2FO8A 2PMZA 3MV9E 1OAQL 2JB5L 4GQ9L 3CVHL 5IOPA 2D2OA 1LJMA 3V0DA 2A6DA 4GXVH 1YC7A 5F0LB 4I0PC 4RFEB 1JGDA 3ML9A 5DUPH 4ANXA 1OY3B 3UEZA 1B90A 1BAGA 1OAQH 4Q6KA 1S5HA 5D96C 3VXME 3OJ2C 1EXUA 1TU2B 1MJ8L 1KIQA 3ZTJG 1BYNA 5I1CL 3O6LH 3O9WB 3RDTB 3HR5B 1T4KA 3I6KB 3VXRE 1WA1X 1R3JA 3CZFB 3D5OF 4X7TB 1Q9WA 1HKFA 1FC2D 2JLLA 3GLDA 2W9EH 4DO5A 3TBCA 2PWGA 2Z7WA 1YNKL 1S7RB 2M83A 1RVFL 2WLMA 5IUCA 1N0LA 3JWDC 4K7FB 1KYFA 1WITA 1PL3A 2BIHA 4L4TB 3S3BB 2QSTA 4YDZA 4FD0A 4LSTL 5I6XC 4OKVB 3WTSA 5DK0B 1Y18B 4GQQA 3BAIA 1CXLA 4HJGA 1ZLEA 1CDBA 2IPKA 5J06A 4PJEE 5K39B 1XGRB 3A23A 4DKFL 2W0FB 1A5FL 4WENB 3QNZB 1K4DA 3NZHL 3SBWC 1DQQB 4AYDC 3OKNA 3MUJA 3JWOL 3QUYC 5D1XC 1YY9C 4L9LB 4FQQB 4Y4HC 1IVLA 2YPLA 4RMTA 1BFTA 3LKRA 3MJ8B 1DVYA 4X42A 1OAYL 2FIRT 1JDDA 3ZUCA 2H32H 3UMTA 4TNEA 4DP5X 4D94A 4UQEA 1XCXA 4QHMA 4BFNA 5MERA 4A04A 3U0TB 4BKTC 3UCQA 4KZEL 4P2CG 2KYIA 3D18B 2A1WH 4E0RA 3TZVB 3H9SD 2CJ3A 1GZHA 3BP7A 5EO1B 3N1FC 3L3OA 1NM9A 3CZEA 3TM6A 4TS6A 2W0LA 3U6RA 4K7PH 5DR5H 2FEDC 3NZUA 1H15B 2JJTC 5DD5H 5BNXD 5I1KL 4WKXA 5CJQH 5F7MC 4Z0XB 1DL7L 4MAYC 3G04B 5FLVA 4PP1D 3KJ6L 2Z8SA 3MV7A 2K8MA 1UXSA 1I82A 3N1QC 3OKOA 3VI3B 1O7DC 5KJ4A 2R69H 4N6RA 3C08H 1G7JA 3FSWA 4AGQA 2DD8H 2KHAA 4I85A 3SDYL 1DJGA 3GXPA 1OCZB 2IPUK 4OIBA 2JJSA 2XG4A 5JOEA 4MCZA 4YE4H 1E2WA 5DZPA 5KOMC 1JP5A 4JS7A 4XMLH 4UOW1 2WLZA 1AI1L 2ENJA 3C60A 1JFQH 3FFCB 3GM0A 1TZ8A 4LDLB 3KL0A 1EGJA 3B43A 4XMWA 5DUBB 1KXQE 2DW5A 3UP6A 4Y16D 5IW1B 2Q8BH 3UPRB 1TEYA 2ITCA 3SO5A 2F1BA 3TVMB 4DGWC 1HZLA 4L3FA 2WYTA 4G7SB 1IZJA 4JO2L 5DZVA 3RGVA 1NA8A 1WLHA 3FCGA 4L0PB 2V7HB 5CMAB 4K94H 2WZPA 3BWSA 2XWRA 5F7AA 3BMWA 3HZKA 3NA9L 3V8OA 2H2PD 4EF3A 1MPAH 5GZOD 1RJLA 4ZMWA 1FFQA 1PLAA 1S7QB 2YKKA 4P4KC 1NANH 1HU8A 3QDME 4NAMA 4J4PD 4FABH 5JIPA 3IJ7A 3RZCB 2B1OA 4GP4B 5CO1A 3SYAA 3S35H 4ZMTA 2J72A 4KGLA 2Y7MA 3B8SA 4I7ZC 5AAPA 5IHLB 5KW9L 2J5WA 1ICTA 4AQOA 2PTTA 1B9KA 2YD3A 3BWZA 2A9BA 4PM1A 4UCFA 4AYFA 4HUXB 1WHPA 3LZFL 3VWJA 2GEEA 1BFSA 2OMYA 5IQMA 3DROB 4JGJA 1O9VA 3U1PA 3ULSB 2HTLC 5JZ7D 3BKJH 1XSIA 1N6QH 5AW0B 4MAYA 1A6WL 3ATDA 1FE8H 5C0GB 3V95A 5K59F 2D7QA 2CBQA 2LQRA 2Y36H 3KBFA 4HQQL 4MXVF 2O5NA 2M1KA 3B2PA 3X11A 2KS0A 5LAPA 1NUNB 1U91B 4XP5L 3B4NA 2ERJC 2Y6SC 5J6HA 1F13A 4B5EA 4KH2A 4X7CC 4JAMB 1BLNA 5H4ZA 3MODL 1MUJB 2BSTA 1NCWH 2OMWB 3NABL 4AVIA 2WM0A 4XH2B 1QD0A 4HWZA 1XGPB 4BXSV 3GM8A 3ISYA 4OUUB 3WL9B 5I8KH 1NFIB 1V7MH 3FUEA 2QGEA 5GRZA 4N0RA 4B7LA 1HCVA 1QR4A 3FQYA 3II3A 1WHOA 1OGAA 1NAMA 4XTRC 1HWHB 4YDJA 5LNEA 5I5MA 4ZMVA 1RSYA 4W4OA 5E7FA 2ZQKA 5L8LB 1MVYA 3APMA 1KJ2B 1M2OA 4LMQI 1Y0LA 2C1PA 3S5YA 1M6OA 4RFNB 4HFUH 1RZGA 2N4IA 2QVTA 5SWSE 4L4VA 3FONB 4QR7A 3TH4T 3ZRCC 3FU6A 4Z7OF 2CMRH 2KZWA 4J5VA 3BPLB 5F9DC 3IPEA 4MNGE 3RWFB 3IPFA 4JRYA 1QHOA 4OCYL 4XOBA 3TV8A 5CS7A 4G7YH 1K3ZA 4P5MB 1W2KT 2XQYK 3VRLE 2JKJA 1QSED 3J8F7 4N25A 3AT9A 4FI8A 4XN8A 4DHLA 5BVJB 1N67A 4WI3A 5I1JL 2D3LA 4KV5E 3OB8A 1MLCA 1K6QL 5DI8A 5B22A 5A6MA 5CJXC 4BYHA 4O5LL 1NFDA 3Q6FB 4U2YA 3GSRA 1KEGH 3LX9A 4ZW6A 4H8VA 1KGIA 2WXGA 3ILDA 3KL5A 4F1ZA 2NX5D 1LP9E 1J8HD 2NY5C 1CG9A 2FO4B 2GK0B 4PRHE 3TYGL 1B4JH 5ICYB 4ADJA 4G71B 1WICA 4H20H 3BZEB 2I85A 4WHYH 3A6CH 5F7YC 3EGXA 3MJ6A 1HVXA 1XSJA 2H2PC 5GZOC 4M00A 3SDAC 4RA0C 2XTJE 1QHPA 5MI0B 4YHLL 4JFDA 4GJTB 3QC6X 1JS4A 3LDBC 5I8KL 3HKFA 1J88A 4JFYB 5B8CA 4ANUA 1A8JH 2EIMB 4BH8B 2ZF9A 1BJMA 4AYEC 1GOFA 4KKRA 3UERA 1TDQA 5HGHB 3QS2A 3SJVE 1MXGA 2HKHL 3CZUB 2XWTA 4EXPX 1TQCC 3LNIA 4PHZA 5F7BA 7FABH 2VC2L 3D34A 2X53A 1KCUH 1PZBA 5K93A 4XNQB 1PMYA 4C83B 3NZ8B 1QSFD 2BX5A 5H37H 2FJFB 2GPZA 2WLIB 3DOSA 3MXWH 4PJ9A 5AOKA 5SWSB 3JQOB 5BV7C 5IWLA 2Z93B 3EYVA 3GMOB 3KHOA 3EADA 1JZ6A 3QXVA 3CSPA 2OI9C 3VD3A 1WAAE 4IIQB 3QH3A 3IEAA 4AYMC 5DGQA 3F62A 1DBML 2GJPA 2JJTA 2EE3A 4ZS7H 4WWOA 4XR8C 1HX0A 3NCJL 4I0PB 4M56A 3WU1A 4WI0A 3B7UX 4MHHG 3ZIYA 3UTPE 2CPCA 1NKOA 1NUDA 3ECQA 5MEPB 4BKSC 4NZUL 2OMVA 1J5OL 4IOFD 5AYUH 4QO1A 5LWYL 1TJGH 1D5XB 1RUML 2R2EB 1SHWA 4N68A 3T4AA 4W4OC 3WS3A 2BO0A 3TEWA 4WEMB 5I2IB 1QFUH 2ARWA 4ZW8A 3ARGA 4L48A 2CJSA 4XP1L 4KROD 5JUEL 1IM9D 5L7XH 2F74A 1LK3H 3DXAB 3RDTD 1NANI 1F6AA 4OIAA 2E75C 5F1KC 4PJFE 3MRCB 4HC1L 1TFPA 2O6DA 4FJ6A 3QR0A 1IARB 4X6FB 1VGEL 3OAUL 1P4LA 3DTUB 4CC1A 3US0A 4F58H 3ZDZF 3HE7A 2UXTA 2AJXL 1NBVL 5GRUH 3RKDC 2IWKA 4IIQC 4PN6A 2PXYD 4AI7A 1OK0A 4TPRH 2A6IA 1T3FB 1SJEB 1TCRA 3MYJB 4LBEB 4MX7A 3EO9H 3WNPA 3EO1A 3GIZL 2BSRB 2P9RA 4PW9A 1U3HD 1IC7L 2B08A 2FD6H 3KJ6H 4PRPB 2DJ4A 1N2RA 4DK5A 3NIGE 5EZPA 2ZUQB 2MIZA 5AZ2H 1H6EA 3BH9A 3KH4A 5AYUL 4JRFA 1I7UA 4ODHH 3MV8D 4P46B 1UT2A 4GS7B 3K5RA 3B1TA 3MV01 1OZTG 5KSAD 2JLPA 3MHZA 1UM4L 4Y89A 1R3IH 3UIZA 2FDBP 2BCMA 3IE9A 4WFFE 1IBGL 2X4SB 4Q9BA 1JI2A 1BOGB 4Y0GA 3M6DA 5KYYA 3QQ9C 4NWUL 2VR5A 2ENQA 4ZMNA 2BCKB 4IKNA 1Z5LA 1V05A 3VWKC 4YHML 2ICWB 4AJYV 3EYOB 5FFLA 3HW7A 3IBEA 1JV5B 4P2AA 2R51A 2YXWA 3UTSB 2J20A 3ZK0A 1TQWA 1TTBA 3KGSA 4IGBC 4U1NA 2QTVA 3KWUA 3ULAB 4QLWA 4PEEA 3FQRA 3FSAA 1S7VB 3APDA 4LSUL 4XN9A 4N3TA 3A3YB 1MFAH 1R9FA 5B38G 2LAGB 2Q9OA 4MFHA 3QWRA 5J8OA 3B2DC 3O81A 3S8FB 2LLLA 3N2JA 3VFWB 1KB3A 3PRZA 1GVIA 4LU5L 2JQAA 2VXUL 4U1HA 4HJ0D 3RJOA 4R6UA 2WP3O 3H8NA 4WI4A 1NLBH 2HVJA 4EVNA 3P2BA 2BY3A 2WSDA 4TXVB 3EJJX 4HSQA 2VR6A 2Z64C 4N0UE 1RIUH 4XO5A 1MQ8A 2IFFH 3S36L 2R15A 4MMYB 5IQOA 5AOZA 2E6QA 1MWOA 3D3VE 4LVOB 1XL6A 3DUHA 3V0FA 5B7FA 2M8XA 3CCHB 5AZ2L 5FO8A 1C16A 3IMVA 1LMIA 3D51A 1H0DB 2Z4QA 1P4UA 1CIDA 2FEDD 5T1KB 2F2HA 1WZKA 2BC4B 4YDKH 2WXHA 5KWYC 2Z35B 5FWRA 4IU3B 3P2DA 4HIPA 4JDZA 2I25N 2Y5TB 5HHMB 4UV7L 2PCFA 3K80A 2L7EA 5JW4N 5BV7B 5IMMB 1F97A 3M1BB 3NAAL 5GS1B 1JZ2A 1I4FB 4BK5C 2ZKMX 5I9QB 1AE6L 2EDTA 3EJPA 1A7OH 3F5WB 2X3AA 4X6DA 4I87A 4F80A 3CBKB 3MREB 4JFFA 5KG9B 3T0EC 1HK6A 4LCCB 1W0WB 1YQVH 2Q86A 4RWYL 3BRFA 4TLTA 3CC1A 5FYJD 1BOYA 3L5WB 3QORA 2IALA 1UUNA 4N5EC 5KYNA 1K6QH 1ZJBA 3HAEH 2DWEB 4QRPE 1OP3K 2CK2A 1LNUA 1B0RB 5HHPB 2PTUA 1ACXA 1LEKA 3BVNB 4TTDD 3F83A 5TF1L 4EOWL 1QFWI 1QRNA 4D9QD 2NX5A 3ARUA 2CDEA 3LTVA 5B8CC 1JWUA 1ZGLM 1RURL 1W91A 2MQGA 3GZOA 3O11A 3VFRA 1FH5H 1JSYA 5IB5A 2N59A 1S3KL 2UY6A 2Y25A 3TA3D 2O61B 5BZDB 3M17B 4FXLA 5JDSA 4TSAH 5JORA 4PRPE 3K91A 4K2UH 4QY8B 5D9SA 4FTVA 4R3SB 1YEIL 1UACH 2CMRL 4Z77A 1XR9A 3QO0A 1PY4A 3C2AH 3VI4E 1OAYH 5JA9A 1BQLL 2BIMA 3S96A 4QRUB 2HUHA 3HE6A 1X6NA 1NGZA 3VFGL 5AG9A 5ISZB 1CFNA 1AGFB 1M71A 2Y5TA 3B56A 2VNCA 3FT9A 3QI9A 1F11B 4RMSA 1S7XA 4XCCH 4L1TA 4AKPA 1JZJA 4YO0B 2ZUYA 5HGBB 3UACA 4Y8DC 3I9PA 2VR9A 4UOZA 4X6CE 4XWOC 2O93L 4P2YA 2V5RA 2R27A 1UKSA 2NR6D 4Q52A 4HISA 1AACA 2JIXA 1SMDA 2XBTA 5E94A 5EBGA 1SMOA 1F1GA 4G8GE 4M7ZC 2FR4A 3GMLB 5HP5A 1SPDA 2VM3A 4O58H 3MBEC 4NYLA 4ZPVA 2V8MA 4UBDD 4HH9A 1G9NH 3JWNH 2MRYA 5IMKB 1NCNA 4PJHB 5AOJA 1OEZW 4HLJA 3EDKA 4NENB 3QULB 2DWXA 4UT9H 2P4AB 3SKOA 3SKMB 2HH0H 1EO8L 2FQFA 2X10A 4P05A 2MQ3A 4GMTL 5DZLA 3WV0A 5ENWB 2O72A 2VITB 3HNVH 1T04A 4MKTA 4N2EA 1PYWA 3CFNA 2VQ4A 1KCWA 5LLIC 5JXAL 1MCJA 4ZXBA 4N5UA 1VGKA 1MHCB 4P5KB 1KENH 2H1PH 4ALAL 5IHHA 1HKLL 4LVNC 4QTFA 5C70A 3O3BA 4NN7B 3NJJA 5AW9B 4KK5D 3M7OA 4U1NB 4LLMA 4XBEH 1T03H 2FVNA 2H8PB 1E4KA 1EAOA 3HVNA 4HX1B 3BSZL 3QZWG 1CIUA 1ASOA 2GFBB 1JGEA 3LJ3A 1COBA 4O51A 4RGMC 1BG9A 5BS0E 4X9YA 5E8NB 1RZQA 1O5PA 3QNXA 1R5IB 2M2DA 1FFNA 3O4OC 4MB1A 4HUMB 3T3ME 2BHYA 2ZSWA 1PZUB 1QI4A 4O4YH 4PJ7B 4HOWA 1QRND 2R1WB 3A47A 4HJJL 4UIMB 5DFVC 3O8XB 5LO7A 3VCLB 4FTVD 2NY2B 1NL0L 5ACZB 3RZCC 4J8RB 2K1MA 2QKIC 4R4ND 1UURA 6FABH 3A22A 3TS8A 2QHLA 4AH2B 5FEBA 1AY1L 3VX1A 3FQUA 3WNIA 1P5UA 1A6ZB 2X4PB 5FYJE 5GS1C 1CPUA 1G7QA 4U1IA 3ASNB 1E5BA 1TEFA 1YSOA 3MRFB 3PWVA 4LCWA 4LCVA 4ZQTA 2R8SL 2B0SL 5I0WA 1HXMA 1WAAA 2Y2WA 1IZKA 2Y2YA 3QDGE 2AVGA 4V33A 5ESVA 1NLDL 1NBYA 2DQHH 2WQAA 3BXNA 4UQ9A 2EVGA 4APQA 4M5YL 5D70H 3RZWA 2G30A 3DGGB 4AT6B 3SDXF 1S7TB 5BOJA 1K2DB 3C2SA 3DX9A 2UUDH 5EC2B 5BVPL 1B88A 1R19A 2F54A 2VZVA 5I1IL 5I1LA 3D08A 1U3HC 3MNDA 1KBGL 4KRLB 4Y4HA 1G1KA 1DUZB 2YMOA 2YAOA 1PSKH 2FJSA 2CD0A 3RVXC 1MQKL 5D4IA 2HLAA 5CCHE 4J3OH 1BD2E 1ZV5A 1P84K 4M48L 5T5NF 3DVIA 3H9SB 4QOKA 1OK8A 4PD4J 4YSEA 5K9OB 3NDYE 3IVKA 4FMFA 2FAUA 4M61A 3ARFC 1RP9A 4RNRB 2DIAA 3DO7A 1SXZA 3EYFB 1I3UA 3N1GC 3N41F 4JY6A 1X9LA 4M48H 4B60A 1RURH 2EJ1A 5LGJB 4KMLB 2L4OA 2WD0A 2VZ3A 2WAQA 5JLZB 3EGDB 1D2OA 4OI7A 1KXTA 2DLHA 4NRZA 4HMCA 4XGZA 3NCCB 4HIHB 4M8QA 4K5OA 4QKXB 2NXYB 4O2CB 3CN3A 1Y1UA 3HS0A 5JXEA 5I5JA 3QWRD 4FADA 3Q44A 1K72A 2AJ3B 3AQZA 1WS8A 4DKEL 2J8UA 5I18L 3L6FB 5J12C 3F85A 3V4PL 4YSCA 4HZ1A 3WY3A 4PJ9B 1N8ZB 1OSPL 1A66A 1G7LB 4B96A 3NSFA 3PE9A 5SWZA 3TURA 3EXJA 4PJDE 1ZLVK 3K2KA 4JRYE 2CQVA 2IGLA 5IVXF 3LKSA 1O5DT 3BMVA 4Y16B 3Q2VA 5EU5A 3RB5A 5F6HI 3L81A 1SBBA 2XTJB 3CVBA 1OP5K 4LHUA 1FO0A 1G7PA 3OV6A 3KWXA 4HU2A 1CGSH 3DUSB 4YR6A 1UM5H 1XZ0A 4PJIE 2AABL 1T80A 1L6XA 1LK2B 3GSUB 3PP3K 4NQVA 1VF5C 5C07E 5D93C 4JFDB 3ZDXB 1MAJA 3SE3C 1EVTC 1R33A 4X4YB 4WGWB 4CMMB 2VDML 4QDGA 5IG7A 3ARDC 1UG9A 2CUMA 3TEYA 1ECYA 5GJSL 3FTGA 2WQSA 3MNMA 3QUMA 4EZJA 4WW1A 4KXAA 4L1LA 4I0PD 1PJWA 3QNFA 1LD9A 3F65A 4G6JL 4RQQA 2CR3A 4BSWB 1N68A 5IVNA 4IRSD 4YX2L 4KVCH 8FABB 2JKLA 4IDJH 4OCXH 4A67A 4AXWB 2EE0A 4FLOA 5D7LA 5DJYB 5DS2A 1VACA 2XQYG 5ILTH 2WHVA 3KYNA 1OAUL 2WUBH 4FMVA 3PAUA 3TCXA 1T0NA 4PMEA 2DWDA 1JTPA 4A2LA 4NUJB 4FQXB 4G6KL 3KDMA 3HPJB 1UTDA 1GC1H 1FAIH 2ORBH 4X5QA 3IE4A 5HYSG 4HZAA 2OBGA 4EI5A 2EUZA 3LXBA 3UC2A 3FQXB 4NQCE 3HUJF 2DLEA 4JFEE 1U4EA 2OSLA 3E8VA 3QQDA 4B9CA 3QSKB 1FSKB 5L8KB 4L4VB 1CS6A 1IC5L 1EPFA 4LSQH 4X6EB 4EZLA 1RVFH 3T8XB 2YMXH 1KULA 2XG5A 3NTCH 2WC7A 4NO5A 1KEMH 5BRZD 3MBED 5GRJL 2HFEB 2MHAB 3QQ3A 3RIAF 4I88A 2WINA 2ZT9C 5BZWA 4KXZH 5HHMD 3EHBC 3WUWB 3ATFA 5IW3A 1W6WA 3U4EB 3EBHA 2P43B 3O4LE 5EFIB 2OTWA 1RAMA 4GKNA 1F3JA 3NUKA 1LQSR 1MWAA 4YDVB 4JL2A 3O2DA 2W0PA 1EEZB 4BCZA 1IJNA 3EH1A 5A2LH 2W9DL 2N56A 4H1LB 1KN2H 3BLBA 4DCQA 4FJYA 4PJ7F 1I1FB 3RVUC 2IOIA 1FBIL 3IAQA 4HUWA 3RWDB 4G9DB 4DTGL 2XU9A 2XTSA 4HP5A 5CJBA 4YLQT 4GG6A 3D39A 1SLVA 4IGBA 3GD1C 4MLSA 2X6VA 2YGOA 5AW5B 1N64L 2HXAA 3MRKA 4ZFZA 3KPTA 1ZIBA 3O9WD 3GSOA 4WGVB 4P5TD 3B34A 4OCWL 5DJDA 4ZSOA 4PS4L 4Y9BA 4OQTH 4Y7OC 2APFA 5D7LD 3U9UA 4MVBD 1CTMA 4X6CA 1PGRB 2AJVL 4TSBH 3VTTA 3WFDH 3B9KB 3NIGF 3VXSB 3LMJL 4UT6L 4ZFGL 1BBDH 4U2ZA 4G7VH 3MRKB 1ZGLP 5EEWA 1QRKA 2CJUH 1JNJA 3NH7L 3D39B 4I1PA 1FFOA 1YEKH 2XN1A 1EO7A 4CSPA 2WZ0A 4KQ0A 4H8WL 4YK4B 3O6KH 4KI5C 3U46A 2X70B 4BUGA 3QYNA 3HHSB 3VXSE 5AEAA 3WXVL 1WH0A 1MRDL 1RUPL 2WCGA 1KTBA 3T0ED 2CLZA 3NBNA 3IFNL 1CCZA 1EEZA 2FJGA 3WEOA 2R0KH 1NGWB 3SDCD 2Y06L 4GKNB 4L8BA 1FP5A 4PJXB 2VSDA 5CILL 3C6LD 2YZ1A 3V5KB 3BIAX 3GINA 2X89D 4NSKA 2YN5A 1F2XK 3IMTA 2CGYA 1WIUA 4JR9H 3C60B 6FABL 1AZRA 3NIGB 3KVQA 4NO5B 4W9FC 4C56E 2DKMA 5FM8A 2BFVH 4M9OA 5KSUA 4BHUA 3Q3GA 5TK2A 1OT4A 2YBRB 1E4WL 4OH2A 3B9VA 4WJKB 4MB5A 3Q1EA 1MJUH 1NGPH 3IDGB 3OX8A 5C0AD 2OK0L 2DV6A 4Z7UB 4WFFD 3H9HB 3FJTA 5AYTA 1C1EL 5KJRL 2PPFA 3LHPL 2CR6A 4FZEL 5EZIL 2QZQA 3GIVA 4ZZFA 1SLXA 1T7XA 1W6LA 1I53A 3HBPA 1J0IA 4IK7A 1FLRL 1TTGA 3P0YH 2NZ1A 4M6AA 4W81A 3PGCA 4Q58C 3KPMB 1DVSA 5D7LB 3A4EA 1DCLA 2X9YA 5LQBL 3CXFA 2FO1A 2P7TA 4P9MH 3UZEC 4XPGL 3VD4A 5DJ8B 3FCTA 2B2XH 4RISL 3KPSD 3PV7A 5INDA 4MJIE 4HD9A 1JN6A 2AQ3A 2P52A 5MERB 2FZ3A 4LMQE 4M7JH 1IM9B 1T1WB 4GIOA 5CP3H 3PFQA 3FF8A 1XF5A 3B1UA 4DUXA 4JB9L 4JFQB 3QG7L 1GGBL 3MJ8A 2DZEA 4PJ6A 4A39A 4ZW5A 2BSED 2BVPB 2CRZA 1HOCB 3OSKA 1ORSA 5CSBA 2Z92B 4I77H 5JHDD 2D0FA 3ATAA 2HT2C 4YDIL 2A4EA 1DQQA 4RSVA 3ZU8A 1TTUA 3VXNB 4JFOB 3CVIL 4NWUH 4ODXA 4QT5A 4JRWA 3VD0A 4FFYL 2F5BH 5HDRA 5T1DL 2DH3A 5AALA 3ARDD 1OTUD 4NPYA 4FYQA 5C92A 4M5SA 4J2QA 2D73A 1QUNB 2IAAC 4F9PC 4UIKL 4FKEA 4OJDH 2WVVA 5DK2A 4O2EA 1T1YA 4PTTA 3ABGA 4PTUB 4RAHA 5A6IA 4Q89A 5I16B 4IBWA 1H3PL 3BWAA 1XIWA 1P69B 4WHYG 1P6WA 1HSAB 3NCMA 4JN1H 2ZXGA 1M05B 3VXMB 2GTQA 4K7PL 4H8QA 3SYCA 4K3EL 3LRGA 2PYEB 2OFQA 3CZFA 4NHCH 2G3NA 4Z6AT 2QHRH 1IC0A 1N9PA 3OKLA 2AJ3A 1T5KA 1GGUA 3GSXB 5E6ID 4Y1TA 1FL6B 1NKRA 5D2NC 4F2MB 2FSEA 5F9OH 2F5AL 3EYUH 2G4GA 5E4IA 1S5HB 4HJ1A 1T89A 2F68X 3ZDXF 3P1VA 2CO6A 3LPGA 4YHIB 2LAAA 4JM2C 2V4LA 4S2SB 3SPJA 2WXJA 3L1GA 5DHYB 4UMGA 3WUWG 4YHNB 5IF0A 4MJHA 2OCFD 1SHMA 3GMNB 4CU8A 1USQA 4Y2DA 5DJ0B 4IHOB 2R1XA 5CBAA 4HETA 2NLJB 6CGTA 1UD3A 1UXWA 1SXCA 2C8NA 4YGAB 4U6HA 3EOAB 1Z9NA 4ZFOL 2F58H 3I84A 3QPQD 1IT9L 1XGUB 3BHBA 1M3JA 3LPWA 3NCXA 4NOBA 5LGHL 1AP2A 1N4XL 3L3IA 2Z6FA 3GSVA 4IOSD 4PG9B 4WFGD 5ITBH 1G0DA 5E2VH 2JI3A 5EC2A 2QQNH 3IMBA 3ZJAA 1U92A 2VQTA 1FA4A 4GMSH 1CYXA 1D6EA 4K5MA 4QHNB 2H0FA 3NPSC 3RNQA 1AGDB 5A6LA 1U8OA 4U1LA 2W65A 4ABWA 5ESVB 3KWVA 2Z31D 3KYKL 5AVQB 2E46A 1A4BA 1J8HE 2X4NB 4IHOA 5KYXA 3HVDA 3FT2A 4BHUI 1U8JB 4XVJH 5IW6B 1I3RA 2N1KA 2X38A 5IF0B 3NIDF 1HKLH 3IDIA 1B2WL 4JCMA 1E5AA 3UX9B 1YECL 1DJIA 1QTPA 2J21A 1SOXA 3VDBA 35C8L 1YA5A 1E5ZA 2XFXA 3MLWL 4EUPG 1AHMA 2W91A 5JW4R 3IT8D 1SFHA 2V3DA 3FB6B 4JQXC 3QHFL 4NKDA 2AQQA 1O9WA 3JVFC 1A25A 2EYRA 2D0HA 4OCSL 1MEXH 1VCBC 5C6WH 1E5CA 1XSOA 3V5DB 2GG1A 3G6JA 4XCFH 1QFWM 5I30H 4OTXL 2HVKA 5IJDC 1DQTA 1Q9OB 1BA9A 2OZ4A 5HHVL 4B5ZA 4UU9B 4PTUA 3QNXB 4Q6IA 4TTDC 4M3KB 3TC9A 4AL8H 1NGYB 5KANI 1KIUB 3WE1A 3PXLA 4NI6A 3O3AB 3SPVB 3WFCL 2ZYIA 3CK0L 4GSDH 2DYPA 2COVD 2ALWA 1UZ6E 5H35B 4DVRL 3MRIB 1NCCL 3PXJA 4RBPH 4TYUA 2C7FA 3BWUC 2QQQA 3QGVA 3ARFA 2F7QA 1DLFH 1QEWA 2EC9U 2CH8A 3LKNA 5IJVB 5A2CA 3MZGB 4OF0A 4JO1L 4O00A 1MFEL 4JQIL 4R7NB 3DXAE 2AEPL 4PGBA 1ORSB 2R4SH 4TRPH 5E5MB 3WEMA 4MA3A 5GPRA 5FK9A 5DJXA 5DJZB 4OZHB 5EDSA 3BDYH 3A67L 3C5JB 4Z7NE 1NBVH 3QUXA 2GY5A 2RQ8A 5FB8A 4DKTA 5KVGH 3MLSL 4PVBA 4TNVK 4UI2A 4Q9RL 1KGCD 3PHAA 4HF5H 1RZIB 4ZMLA 4HG4J 3FO0H 2CO4A 3FOLB 2C1OA 4IOIB 4MASA 3WSQL 4D0DA 1BJ1H 1WPCA 2I9TB 1FG2A 3OLEA 3V4PA 3KDPB 4Y5VC 4N4YB 2J25A 4G1MB 5L88H 2Q76A 4YEFA 1ZHNB 2DQFA 1ACYL 3MRBB 1WA0X 4E9RA 2FQGA 4GRWE 4TLKA 4Y8AA 3A4AA 3G7TA 2P5WB 4Q4IA 4PJHE 2FNBA 4DVRH 4UINH 3AFLA 4GUPA 4CC4A 3NYKA 4IS6B 5GXBB 2E4FA 5FCUL 4QRUA 1TQBC 3FZUD 3HMXL 5DVPA 3KPQA 3POCA 2C9AA 1HS6A 2ROXA 1PG7X 2OJZH 4HDIA 3V4UL 3EYQD 2IGFL 3D6GA 4MAUL 5FO7B 2G5RA 2W5PA 4PRHD 3UTZA 3RNKB 4A66A 1DVFD 1A1MA 2EADA 2GCYA 1LEGB 3I9AA 1RJYB 1LM8V 2VXTH 4KXDA 5I1EL 1U9KA 3B7YA 1GYVA 1NGWA 4YAQB 4HV8B 3OAYH 4JZJC 5HHPA 1B0RA 7FABL 4XE0A 3FO2B 3GJEA 3P4OA 1BQ5A 4PRIA 2DF3A 3SGJA 1T1XA 5KVDE 4X5WA 5B1CA 4JJHA 4GQ9H 4JDEA 4MDIA 1E4JA 1LO3H 2VDQB 5F7DA 3RWGA 4EDXA 2F7RA 1TVBB 1UA6L 1F0LA 1MG3C 1NAMH 1XGZA 3MUZ1 3SBWA 5LVEA 2BP3A 3OKMB 1PY0A 4XRCA 2XY1A 1S7UB 4DSYA 4JDTL 2R9HD 1A4AA 1UA6H 4YHZH 3GJFK 3FFDB 5A1AA 1F58H 1E4WH 2AV1A 3G6JF 3RHWK 2E9BA 2BNQB 2RB8A 1JRHL 2H2SC 1V3MA 2G9KA 3VFMB 4WWKA 3HZYA 5CZVH 5KYWB 4Z7OE 2F9BT 1R5WB 3EHBB 3LYRA 5E95B 1HT6A 4HOZA 1XCQB 3GHPA 2NY5H 1R0AH 3EIFA 4M7KH 3B5HA 3CH8A 3O6FB 1D9KA 4GRWB 3QDGB 2BNQE 3M88A 4GBXB 5CILH 4NZTL 4AZUA 2CHDA 5FCUH 4IBVA 1E9OB 2NDFA 4X8JB 5J1AB 3MCLH 1M9WA 2M26A 2ARJA 1U3HA 2VLRE 2VMCA 4N2IA 1BLIA 5FHAL 2OJZL 2A5UA 3V4UH 1UA3A 4QF1A 5A2AA 4MA8H 1F4HA 1KGWA 5DS8A 4UQCA 1I7TA 1F3JB 1O7DE 1NDMA 2HB0A 2WUCL 3KPSE 4FQ2H 4XC1H 1QLEH 3T0BA 1P1ZB 3QPQC 1Z9OA 2H3XC 2QADD 3ATEA 4OJAA 4XCFL 4U05A 5TE4L 1I1YA 2WINB 5BZWB 1DVFB 1X7SA 1OGSA 3DGDA 3HA0A 2VXQL 5EWIH 1YNTF 3ET9F 3MGOB 1PZCA 3STZA 3TN0D 2WQRA 3E80A 3NEOA 3S35X 3TTSA 3ES6B 4K3EH 3VWJC 3WJJC 4BWWA 5FKPA 5BV7H 1EANA 4XNZC 1F3DH 2DQUH 4IRJA 4YZWA 4BJLA 2JTDA 5AVXB 4DUVA 3FQXA 3AITA 3KBHE 1T6WA 1FV1A 2AQTA 5DYFA 1NTDA 2EVFA 4CW1B 3N0AA 3EJQA 3MRQB 3N9GL 4HEME 1UKTA 2YA1A 3KCWA 4JKKA 1SJHA 4X0KB 4XCYA 4ALAC 1SYSA 2OMXA 5EEUA 2IFFL 2GIYA 5EBMB 5I15L 2R2HB 3RIKA 2PCPB 2B3IA 4UAOB 3TJHD 1C08A 1CT8A 4ONHA 1AGBA 3MUGA 2V2WB 4KO9A 3L8QA 4R7DB 3WIIL 3ENEA 3IS1X 3A67H 4QI3A 5FA4B 3MRGA 2C9VA 3P54A 5DQJA 2PPDA 4XNDA 3KYMA 5C7XH 3STBA 4RWHA 2HLEB 2A77H 1XXDC 4FQHB 4UQAA 3HG1D 4QXUH 3MSPA 3HC3L 4FNLH 1AD0B 1YMMB 3RTQC 4IBTA 3V55A 4YXHH 3FO1A 4QNPF 5E9DB 4JUSA 1WAAF 4KQ4L 5E5LA 2NNXA 4FULA 1WTGT 5AB0A 1K4CB 1SOQA 4HWNA 3UEQA 1BP3B 2OMTA 1ZSDA 4Y5XC 5LBSH 1E27B 1EJFA 5FPIA 3VFNB 1MVUB 2EECA 4I8DA 1JGVL 5G4OA 3B7RL 1AXIB 2J2ZB 2Y4SA 5B38B 1LK2A 3GSUA 43CAA 2BSRA 4MCYB 4UTAL 4OD3H 4QHKJ 3M45A 5E03A 1T66C 2HUEA 3KNBB 3MACH 3RUGA 1W0VA 3FU5A 3ILEA 1V3KA 3X2QB 2PABA 5IMOA 3TEXA 4OCNC 2F54D 1EXGA 2CK0H 1U8HB 2ZP0T 4R96A 4WFED 3TJPA 1KN2L 4N2KA 3QHFH 3KGUA 5JO5B 5BXFA 3B2XA 3MRJB 3Q43A 2WXFA 1R24B 1I31A 5HDBE 3M7FB 3LRSA 3AM8A 2JCCB 2YGNA 1CXHA 1QW8A 1TLKA 2YBGA 2YGQA 4MJ5A 4ZRGA 5JYMA 1XGQA 3SE3A 1U58B 4EAEA 4CMHB 3FF7A 2DLTA 5E4OA 2MPAL 3HAEA 4JGUA 4P23A 3ML8A 1CYGA 4Z7WA 2EQDA 2XICA 2Y1YA 1CGYA 1FZKA 4XI5C 1PKQA 4N0FB 3OSVA 3CXHK 4ZTOH 5IHUH 1NSNL 4DQOH 5EUOA 5IJCC 2ZCKL 3MUHL 3WS3B 1WQVT 2EZ0D 3T4AB 3R18A 2X0UA 3CFBA 2PWHA 4MLIA 1JHTA 5F1OB 5IB2B 4PBXA 2OMVB 2WCPA 3HG0A 2DM2A 2X87A 1IKNA 2MCMA 3AWGA 1S5IH 3D3VD 4F7EA 5C0JA 1RPUA 1BAFL 1MREL 3QIBC 3BDYL 1M1XB 1GY1A 3ARYA 5DJCB 3EFDL 4CN6A 3E1ZA 5BJTA 3WLBB 4QOKE 5ABDE 1OTTC 3QUXD 5JIHA 2BIQA 2HJLA 2Y5EA 3LD8C 2VISB 4NQXA 4JO4L 4NZFA 3ECBB 2CGZA 4A2MA 3EFDH 1S9KC 1BPLB 1GSKA 3CH1B 1M7DB 4KHTL 4XPGH 4POZD 2ICWJ 2JCCA 3SDCC 2B2XL 5J3HD 3NIFB 3T65A 3VI4A 1P6AB 2NYYD 3BYYA 3IKCA 1JYVA 2ATKB 3TFKC 4XO3A 1ZTXH 3L17A 5IESL 3RVTD 2V5YA 1KSRA 1HOEA 1YUKB 4N0YH 1XMWA 2XWTB 2XTJC 4P3DA 4LSPL 3ELQA 5I8EB 5HYJA 1U8NB 2EDJA 2LGNA 2W59A 4NNPL 2WO2B 2F53D 3GSNB 2DI8A 5DT1L 3NIFE 1XCTA 3QORC 5LCVL 5JW4M 2ID5A 2AEPH 3C8DA 3DUUA 1I1AA 3L3HA 3KW7A 3LQAH 3HG3A 5K5YA 3GLAA 2QFRA 1AHWC 2WUBL 5DYOB 4GB9A 3QWOB 2ATKA 1B6UA 1MRFL 1FGNH 4OLWH 4KK9D 2YXMA 2DQIH 1HL4A 3N85H 4G9FE 4J3OG 3OZ9L 1UHVA 1YAIA 4I3RH 5DD3H 1FDLH 3OGOE 4Y1SA 3BH8A 1Q9KA 3QBTB 5SWQB 2H5UA 1OKEA 3OXRA 4IMLB 4TKWA 5E9DA 3BRGC 2P80A 5E6IB 4L18A 4EZKA 1FFPA 5ID0A 3A6BL 3BP5B 1TF4A 4MQTB 3O0LA 5L0QC 3X13B 5K9KB 1JDAA 2F53E 2AC0A 4Z7VF 5FA4A 4OGQC 2VDRL 2VYRE 5SX4I 3N40F 2F8VA 3ULUH 1IMHC 1HHHA 4D8PA 1PDKA 1FG9C 1E8ZA 4M7JL 3WI9A 1IEBA 5T33L 2EKSB 4U6YB 4P23C 1JHTB 4OZGF 3RE0A 2H32B 3TESA 1L7IL 1MIEL 2WB7A 3HAEG 1GZQA 1NMCB 3D87B 3H9YA 4JPWH 1MHPH 4U6XA 3V4VB 4LO9A 2BS8A 3U9PH 2NXZC 3STLA 4ZW3A 1L7IH 1MIEH 5C3IA 2HKAA 4U3CA 2ESVB 3F00A 3QJVB 1AS7A 1H3GA 4WO4B 4XVOA 3J2PA 5TQ0H 1HZHL 2ALAA 2WNGA 3L4VA 2NPLX 4NC2B 4P23B 1NMAH 3CFKB 4M5ZL 4TLUA 2AFNA 3D4YA 3QIWB 5CSZB 2YKLH 4LLYB 2WWNA 2V17H 4PJEB 5FYLE 5I75C 3GMPB 1MRCL 1OM9A 3IU4L 5DJAB 5E1IA 1R3IL 1J05B 3Q5TA 5LCVH 3E6HB 5SV3A 3DRTB 3G6AA 3C87A 5ITBL 4ZPVB 2GB2A 4WTWA 4G8FB 3K6SA 1D5IH 1WD8A 1ERNA 3BE1H 5FECA 4FAAB 2MKWA 3OLIA 4MCNA 1MRFH