6PCYA

Crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport protein(cuproprotein)
molecule keywords PLASTOCYANIN
total genus 22
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1986-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 6pcyA00
2PLTA 2Q9OA 1RCYA 2PPDA 3IBOA 1NIDA 2FWLB 5B7EA 4E9SA 1JXDA 1GY1A 2XLLA 2Y1AA 4A2GA 2B08A 1OV8A 4M3HA 2GIMA 1AAJA 3ZBMA 3IN2A 1A3ZA 3X1EA 5F7BA 1M56B 1AS8A 1WA1X 3NP4A 4DPCX 1IUZA 4AI7A 3EH4B 4HZ1A 1NINA 1N70A 2YAPA 1ILUA 5AKRA 1BAWA 4DP7X 4DP8X 1PNCA 3NSCA 4QKTA 4AKOA 4N4YB 1A65A 1GY2A 1ADWA 1BQRA 1PZAA 1F56A 2FTAA 4GXFA 3X2QB 1ASQA 3CVDA 1KV7A 1NZRA 2VW7A 1DZ0A 3DIVA 1L9TA 1RZPA 2A3TA 2PPFA 1AZRA 4E9XA 1KDJA 1MZYA 4KO7A 1J9QA 3TASA 3G5WA 2HRGA 1AS6A 2DYSB 3EH3B 1E65A 2PCFA 1A4CA 3BVDB 1EHKB 2X88A 5PCYA 2XXFA 2FT8A 2FJSA 2EILB 1IC0A 3ZX1A 1ETJA 1JZGA 2VM4A 1ASPA 4ZK8A 1JVLA 3FSAA 1PNDA 3QJQB 4JHVA 4YSPA 3AG3B 1B3IA 3ERXA 3IE9A 3NJJA 1OF0A 4HCGA 3AW5A 1UATA 1URIA 4YSCA 1ET5A 2GC7C 2EINB 3V9EA 3ABMB 4E9VA 2ZXWB 1E67A 2JFCA 3QJTB 1OE1A 4MFHA 3T9WA 4P5SA 4DPBX 4UANA 2BHFA 5I6NA 5B7FA 1N68A 3S3BB 2R7EA 5AZUA 4DP6X 4EF3A 2IH8A 1CYWA 3TBCA 1PLAA 3ZIYA 2HX8A 4KNUA 4F2EA 1L9SA 1SFDA 1ET7A 3D12B 2AVFA 1WA2X 2CJ3A 1TEFA 3GYRA 1J5DA 3H4HA 2OJ1A 1NIBA 2UXFA 4BXSV 2XV3A 1GW0A 1HAUA 2GHZA 1L9OA 2YAHA 3UAEA 5IY5B 3FSZA 3WKPA 2Q5BA 3UADA 1X9RA 5I6LA 3ABLB 1BXAA 2JKWA 1JZEA 2X87A 2QT6A 1MZZA 3QJSB 1AOZA 2H47C 4BWUA 4KOCA 2YAOA 4KNSA 3RYMA 1NWOA 4YSSA 3ZDWA 2PPAA 4YSDA 4YSEA 3MX0B 7PCYA 4HCFA 3JTBA 2CUAA 1NIFA 2N0MA 4HALA 5D4JA 1QLEB 2BP8B 3PPSA 1FFTB 4RH4A 1E5ZA 4YSQA 1W6WA 4PAZA 3QQXA 1MDAA 3NJHA 1XMEB 4A67A 2XV0A 3U25A 4DP0X 5I6KA 1GS7A 3NJLA 4YSRA 4E9QA 2XXGA 1FA4A 1AS7A 3SBPA 4NAJA 1RKRA 2UXTA 4YSAA 4G7SB 5B3SB 1KDIA 5ANHA 1I53A 3CDZB 1HAWA 2FT7A 4NB7A 1SHWA 2IDFA 1PLBA 1AZCA 2VW6A 4GP4B 1OCRB 4YSOA 1KGYE 1JZFA 3QPKA 2HRHA 2FNWA 4A68A 1CUOA 2LLNA 2DWSA 8PAZA 2CAKA 2VM3A 6PAZA 3FU8A 4F7KA 2PPEA 2QDWA 2HZHA 3FQ2A 4A2EA 4BK5C 2XWZA 1OCZB 3WKQA 3EHBB 1A4AA 1JZHA 3FQYA 4HIPA 5TK2A 2FQDA 2WSDA 2BP0A 1NICA 5B1AB 3CVCA 1T5KA 1PMYA 5TK4A 3ABKB 3ASOB 1TU2A 5I26A 3IN0A 2MRYA 4BXVA 3TU6A 5B1KA 3PLYA 3NP3A 2NRDA 3OMAB 1WS8A 2FT6A 2XU9A 1E30A 4FAAB 4GP5B 2PCYA 5F7AA 3UACA 1L9PA 3FT0A 1TEGA 2EIJB 2DY2A 1SHXA 2GBAA 5D4HA 1AG0A 2JXMA 2FQFA 4KO6A 1X9UA 3WNIA 7PAZA 3HB3B 2GB2A 3KW7A 5D4IA 3X1FA 4HAKA 4BWTA 1PY0A 1PCSA 2OV0A 4JKNA 4DP1X 2BWIA 4PCYA 3NJIA 2XYBA 3V9CA 3S8FB 5LDUA 1TKWA 3FPXA 2UXGA 4AZUA 4G7RB 5EHFA 2I7OA 3T71A 1FWXA 3UABA 1QNIA 4YL4A 1M57B 2W88A 4YVNA 2FQGA 1BXUA 5FC9A 1AZUA 3OM3B 2FQEA 3S8GB 2XV2A 4F2FA 3AG2B 4N8UA 1J9TA 3X1GA 2VSKB 1AQ8A 1SF3A 3S3DB 2ZOOA 2J55A 2J56A 5A7EA 2J57A 1NWPA 3DTUB 1XB3A 2ZWNA 1IBYA 3FU7B 1WA0X 3NJGA 3FQ1A 3NYKA 1BYOA 2YXWA 4BWWA 1SFHA 2PPCA 2UX6A 4DP5X 1WS7A 4K9JA 2BP8A 4HHWA 1NTDA 3FSWA 2HX7A 3QJVB 1DYZA 4E9TA 3WI9A 2MTAA 2YQBA 2BW4A 3N55A 4G7QB 2CCWA 3UGEA 3KW8A 1OOWA 2PP7A 3PAUA 3NSYA 3NJNA 2BZCA 3FU9A 1NIAA 1KBVA 1KCBA 1JZJA 5PAZA 1GR7A 4W1TA 3IEAA 1V55B 2YXVA 1CURA 4AKQA 2B3IA 1W6LA 2GSMB 1JERA 3UAAA 2WO2B 1GYCA 1IKOP 3EF4A 3PCYA 5AFAA 2XX1A 4G71B 5B1BB 4G70B 3SQRA 1NDTA 2AZUA 3C75A 1J9SA 4P5RA 4A2FA 4ENZA 3X1NA 1AANA 1BYPA 3OD3A 1EZLA 1CC3A 1JXFA 4DPAX 3NSFA 3PXLA 1PZCA 3FSVA 4TXVB 4CSZA 2PP8A 4WTQA 1SDDA 2BWDA 2HXAA 2IDUA 2VW4A 2RACA 2IWKA 4KO5A 1VLXA 3AG1B 4X4KA 3FPYA 5I6PA 1AZNA 1KBWA 3HEIB 1NPNA 1ILSA 1W8EA 4HHGA 2TSBA 4WKXA 3SBQA 1AG6A 1XB6A 1BQKA 3H4FA 4Q89A 2XUWA 3NT0A 1OCCB 2I85A 2YARA 3CG8A 1XB8A 1ID2A 2DV6A 5B1JC 3N2JA 2QDVA 1AR1B 1R1CA 4HCIA 3NJMA 2BW5A 2P80D 4GY4A 4NERA 1E5YA 2BO0A 3CZUB 3ABGA 1M9WA 2QPEB 3EH5B 4YVUA 5B1JA 3CVBA 5I28A 2VN3A 4E9RA 1A8ZA 3X1BA 1ZV2A 1V10A 1ZPUA 9PCYA 2IWEA 1MG3C 1PLCA 4FA7B 2YAQA 3QJUB 2YAFA 3DKHA 1RZQA 2AANA 4A2HA 2IH9A 2XVBA 2HLEB 1V54B 1JZIA 2W8CA 1L9QA 4YSUA 5I6OA 1A4BA 4JHUA 2IDSA 3AY2A 1QHQA 2R7EB 2GI0A 4KNTA 2J5WA 3OMIB 2Y69B 2BZ7A 1AZBA 2H5UA 1OE2A 1PZBA 3CDZA 1AACA 2IWFA 4AKPA 1WAEA 3SBRA 4L0PB 2CALA 3BQVA 1PAZA 2H3XC 5I5MA 2WO3B 1HFUA 1KYAA 2BP0B 3T6WA 3OMNB 1J9RA 3PAVA 2QPDB 2XX0A 4UF7C 3TBBA 5I5IA 3NSDA 2VSMB 4DP2X 2EIKB 1ZIBA 1J5CA 1BEXA 2EIMB 3AG4B 4DP4X 2UXVA 2YAEA 1BQ5A 3NJKA 2IAAC 4E9YA 3L45A 4AX3A 1ZDQA 1NPJA 2ZONA 4CSPA 5I6MA 4UAHA 2VMJA 4GYBA 4A66A 5B7MA 2IDTA 3FS9A 1JVOA 3FYEB 1SF5A 2E86A 3TA4D 1IBZA 3GDCA 4YSTA 3T6XA 2AZAA 3MBWB 3T6VA 4E9WA 2I7SA 3WNJA 4W9ZA 3WIAA 3AZUA 3FYIB 5E9NA 1SNRA 1AIZA 2GC4C 1NIEA 4M4RB 4BDVB 4KO9A 1ZDSA 4Q8BA 1ET8A 1MG2C 2HX9A 2PP9A 2YAMA 5I5JA 4A2DA 2IDQA 2TSAA 1GS8A 1PF3A 3GXUB 3NJFA 3JT2A 6PCYA 3PAZA 3OQRA 3QJRB 1OCOB 4BDVA 1ASOA 1JOIA 4GP8B 2OCCB 1YLBB 1GSKA 1CYXA 1OE3A 3ASNB 1SDDB 1ZIAA 4G72B 3FU7A 4QLWA 3WG7B 3S3CB 1JXGA 1L9RA 3T6ZA 2P80A 4KOBA 2UX7A 3H56A 1BXVA 1KCWA 1SJMA 2AFNA 1GS6X 2DYRB 2DWTA 2CBPA 4DP9X
chains in the Genus database with same CATH superfamily
2VAJA 3MRJA 4R26L 1IGIL 4XBGA 5C0NC 4XPHL 3OHXA 1TJIL 3PGCB 3BXNB 1RSFA 3MRPB 4NSKB 3ZUNC 2F5AH 4C59B 4XP9H 2E7HA 1X5YA 5GSVA 2MQGA 2FYYA 2I24N 3QHZL 1QFUL 4YHKH 1AS8A 1YEGL 1P1ZA 2H26A 4OF5A 3A0OA 4CU7A 3H9SB 4HPHA 1UM6L 4KRLB 4MQXD 3UZEA 4O4YH 4XC3L 5GGVY 1E6OL 2CO2A 4DKEL 2B3RA 4L0ZA 1DE4A 4XZ4A 1C08A 1SVBA 1Q72L 7FABH 5CLWA 4MD5A 3H54A 2ITFA 1D6EB 5CLYA 4TQEL 4A55A 4YAQA 4EKXA 3B3IB 5JPNA 5F1NB 3V4PA 1NAMB 3MRCA 1MCNA 1OK8A 1SY6A 3WHE1 3DURA 5I15L 4HKZA 3M45A 4TUOA 4PRDB 1JNJA 1PZ3A 3FT1A 3CMOH 1VKXA 4BGDA 4FFVD 5HHXL 5CD5D 4IGBC 2D2CC 4AEEA 4PLJC 1TQSA 4IJTA 4LEXH 3VD4A 4ZXBC 2YSSA 4NO0D 3GFUA 4PJXE 1AGCA 4I0CC 2P8LA 1N64H 3VA2C 4F24A 4PJXF 5BMFL 3QJQB 4LT7A 1BREA 1W8NA 3AG3B 4Z7VB 3IE9A 3NOIA 2HFEA 2NY7L 4FRWA 1U3ZA 1L7IL 4YK4B 1AMXA 2WGNB 4MB1A 1TJGH 4K71B 1PL3A 4D0CB 4JRXB 5CP7B 4HJJL 2I9LA 1QSEE 4JFYB 4WU5B 2KMWA 5I75B 3KYKH 4CVXA 2XTJE 4X4MA 4RISH 2O5ZH 4XOCA 3U7YL 3UPCA 5B7FA 2WLZA 4A7SA 2FBJL 2IH8A 2J8OA 4J2QA 3ARTA 3PHOB 1JV5B 5IVXA 3BH9A 1Z5YD 3D69A 5ITBH 3S3SA 2IF7A 4TL5A 2Y72A 1UD6A 4PR5B 1I82A 5DJ8A 5TDOB 1DQMH 4GT7A 3NUKA 4Q14A 1R0AL 2UXFA 4WV1A 4WV1B 2FUTA 3FCUB 4YE4H 5DMYA 1A1OB 2OMUA 2KPWA 2OR9L 3HJEA 2NCMA 3DVGB 5AOZA 1N2RB 5LAXB 5ISZB 4XMKH 2LVEA 2WQRA 4JRYE 3CWGA 4WGVB 2DL2A 2B5IB 4KKLD 2W95A 3ECUA 1HZKA 3QIUA 5F8QC 4PJ9C 3DXAB 1PZ5A 3I6GA 4KRPC 4F8PA 3AQZA 4L5FE 4PW4A 3AWEA 3WD5L 4OVUA 3QRFM 3GK8H 1G7IA 1ZLUK 4LL4A 1PX3A 4PTUA 3FN9A 2N0MA 5DRZB 1T2XA 4HUVA 1PEWA 1Z0NA 2P5WE 2OKMA 4FNQA 4AIXA 3IDMA 3MCG1 2F7RA 3DX1A 3BP4A 3S6CA 3ZDXE 4ZMTA 3OGCB 4G9FB 1KY7A 3Q9PA 5GGSA 1WBYB 2VLMD 1GC1H 3UMTA 4BZ1H 5C0CA 3MNDA 1JZ6A 1BF5A 4JY4A 1OHQA 4P8QA 3VXNA 3ZR5A 3OF6A 3IRZA 3ARRA 1PGRB 1UGKA 2MTPA 4JW3A 4FFWD 4MTMA 1F2XK 4JDTH 4NAJA 2WINA 3GMLA 5BRZB 3SKOB 2VWEC 4ALAC 1MNNA 4XPHH 4ZMWA 4KTDH 2RQ8A 1SN5A 4G1MB 1HESA 3M86A 3LYRA 1IAOB 4XCEB 4W9KC 5BRPA 1WT5C 4AYFA 1S9WB 2HWZH 2NLJA 3QHZH 4YHKL 1QFUH 5KWYC 3RLSA 5EFIA 4IDJH 4QOKA 5L0QB 5C0BA 3IFOA 5E6RB 3VG0H 4F7KA 2VL5B 1I8KA 4Q7DA 5E2VL 3BVUA 1E6OH 4LHUB 2DQUL 4LHUA 4RFOH 4NQCD 1OCZB 5HGHA 4RNRA 5HGHB 1Q72H 1LEGB 5ESAA 3S3PA 1N5AA 1CLZH 1DBKL 4M1DH 3GNMH 2C7UB 2WSDA 3L4WA 1NOFA 3QIUD 5GZOA 2XWJB 4EKJA 5I15H 4JO2H 1IAOA 3BUDA 2RMNA 3TU6A 4Y4HD 2UWEA 2W81C 4Q6IA 2FWSA 2JKTM 1T20B 3NP3A 3TBYB 4FCHA 4UUJA 2XU9A 1MCIA 1N12A 3Q0HA 4N90D 3FT2A 4Y5VA 3P9MB 2XTJC 1HKFA 3SJVE 1U2CA 2FWOB 3GMNA 4P46C 5E8EB 2VISA 1TXKA 3WS3B 1KV3A 3FTVA 4MKMA 5ICXB 4PU2A 3K3QA 5AW6B 5F9OL 3EOAB 4Y8AA 2OV0A 1XL6A 1ADQH 5FO8B 3UROR 2P47B 5L88L 4PBDA 4XMXA 5ESQA 5LDUA 3VFVB 2BHUA 2HPTA 1I1CA 3FTXA 5AL0A 1SDYA 4OZHF 5H35B 4IRZA 1AIFB 5H35A 1SOXA 2XXCB 4PJXA 5F3BB 3M1CA 1BMWA 3AU1A 1LO3L 1XGPB 1HHIA 4LOUC 3G6AA 3VQLA 3OM3B 3D4CA 4GFTB 1JS4A 4MA1C 3FN0H 4RISL 4JG0L 3IMVA 2WXGA 4ZS7H 2EO9A 2FBJH 5C8JB 4ZD3H 1QHOA 4WFGE 2VRQA 4PW3A 3CPLA 3GSOA 5CU9A 3F2LA 1G0DA 2Y2WA 3RWEB 4LRNL 1G7HB 4KFMA 3ZZQA 5EBWA 5B4MD 4TVSa 1DQML 3FFCD 1UXWB 3UH8A 3PFQA 3VXOA 2AQ2A 1UHVA 3K7UA 3C6LB 4H8UA 3RAJH 2YRZA 4Y9CA 5D96B 4NKMB 4HHWA 2WN3A 3DMMC 3NGBC 4HHAA 3RZCC 1HE7A 1OSYA 4RZCA 2MTAA 4FNLH 3IS0X 1ORSA 4M8VA 3DSNA 1GGCH 5DQ9A 3UOAB 4JPVL 2YC1A 4QHUA 3UBXA 3V6ZB 1ROWA 3ZTCC 2FH8A 1BQHG 4JCLA 2NTFB 4YHNA 1KNOB 5LG6A 1ZA6A 5GRUH 3U0WL 2VDLB 3RWEA 2A73B 2IAND 4TOYH 2WVSA 3AXHA 1MH5B 3LRSA 1K6QL 4UTCA 2YD8A 4PW9A 4K2UH 4U3CA 1GC1L 4BZ1L 1T66D 4PTTA 5CEZE 4G70B 4KROB 3L3JB 1IEAA 5BZWB 2QV4A 3IBEA 4BEIA 1A7OL 4EBQL 3RGHA 2X41A 43CAA 2O6PA 4QHPA 5BXFB 4JEGB 5E6IC 2EVIA 4FJZA 3FSVA 4I1RA 4U49A 1UACH 1SDDA 3U4KA 2VW4A 5DGQA 1TTUA 3KDPB 3HLAB 4W9EC 1BSIA 1HQRB 2LLGA 2YA0A 3RIFF 2HKAA 3BMVA 4PJDB 4PVMA 4JQIA 3TH4T 5CCKH 5JDSA 3ZRFC 2XUWA 4JJ5A 5F97E 2XKSA 4E5XB 5EV7A 4QHMA 3VXMD 4FG4A 1ID2A 2OW7A 4QHNB 1MDTA 3ABZA 3MUHL 1HI6A 1RK7A 5BPPA 4UUJB 5JUEL 4C56A 3W57A 1CLZL 1DBKH 5G55A 1OW0C 2HMIC 1BPLB 3K6NA 4NERA 1BZ7B 1KYFA 1E5YA 4IKNA 3H2QA 2PR4L 5K9OA 3MUUA 4JO2L 5J3HC 1HHKB 3NH7L 2DOCA 1U21A 3WO3B 2I07B 3BP5A 5KYYA 1CFNB 2CD0A 1K72A 3MNZA 4J1UA 5IFHH 1HEZB 4AYGA 2EDHA 2BVTA 1KJMA 1C5CH 1X3DA 1RV6X 2IH9A 3VFPA 3VTAA 5FOBB 4UBDD 5JW4Q 1L9QA 1A3RL 4X0NA 5F9OH 1AD0A 3DVIA 4NQVA 1ADQL 1QO3A 1YNKL 4XWOC 4BJLA 4QRTB 5L88H 1K8IB 2WAQA 4X7SL 1O7DE 1WO2A 4JY6B 4QYAA 3S4SB 1UA7A 1JZ8A 3SOBH 3WJLC 1WAAE 2C9PA 4KVCH 1S8DB 2DQHL 4ZFQA 3H9SD 1I7RA 4X98B 4L0PB 4QRSB 5KVEH 4NZUL 3ME0A 3Q1EA 2BIIA 4WIQA 1HH6A 4Z5RB 3PNWA 5HPMA 3OX8A 3QJHA 4R2GD 3S37L 5T1LD 4ZD3L 1U8MA 1VSCA 2XN2A 2AVGA 3ZE2B 1E3XA 1ZT1A 4LAQH 4LRNH 5HGBB 4CVUA 5FFLA 3D8MA 3EW3B 1CO1A 3L95B 3VFNA 2V3EA 3AC0A 4PV8A 2C3VA 3G5ZA 2EABA 4BRJA 1IE5A 1ZHBA 2WW8A 5B38A 2UY6B 5E4OA 3E8VA 5IMMA 4P5KB 2F74B 3K6OA 1A8JH 4UM8B 2JE8A 5D71L 1LXMA 4YGVA 4YHYC 4JPVH 3SKJH 4Z23A 1OP4A 5IBLD 1I8LA 2CXGA 4NQDB 4NZTH 1M05A 5CFAA 1IAKB 1P6AB 4E9WA 1F6LL 1RPQA 4Y19A 2VDKB 4JGMA 3SE3A 3FYIB 5E9NA 5C08B 5DVPA 5E5UB 5GRUL 3FFDB 3QG6B 2R0ZL 2P8PB 1CFSA 1WVZA 4OF8A 1G87A 3EF7A 3LKQA 4G7VL 4C57C 2D4FA 5KYUA 3C09C 5EPMA 1DJXA 1K6QH 1TZIA 3MXWH 3ARPA 2W07A 3EYVB 2CLRB 4K2UL 3L4XA 4L29B 2NY2C 5ID1A 4YEFA 5I8KL 1A7OH 1FN4A 2HA1A 1KB5H 3RZWA 3QJRB 5AVYB 3U48A 4OJEH 4ZAKB 3O3BA 4EBQH 5KVGH 4P9HL 3D07A 3TM6A 3HAEB 5LGKA 4Z3HA 4P2QD 5KS9A 5DVOA 3ZE0F 4XXDB 5HHOD 4L1BA 5HXMA 3EFOB 3II1A 4CGUB 1OM3L 3BQUD 3DDGA 1NLDL 5IGXL 5C3IA 1FVEA 3L6FB 3LS5L 1JXGA 4NXKA 2VMFA 5T1KA 1LGVA 3SDXE 4TNFA 2WKGA 1DBJH 1KTCA 2OSLB 1DN0B 4N8PA 2X2YA 5IQOA 1ZV9A 1N10A 4NI3A 1NM4A 5FYJH 3RU8H 3COOA 1LWHA 1S7SA 4OI9A 3KEHA 3VSVA 1JF6A 3VWKD 1FL6B 4R5XA 1J88A 3DGDA 3QVAA 5KYYB 3K5RA 2Q7NA 2FWLB 3HG4A 4I2XE 5JUEH 1QI4A 3DI3B 4XN5A 2X5PA 1H8NA 1Q94A 2CM6A 2Y1VA 3JV6B 3KDMA 5I0ZA 3IN2A 4AIOA 2WBJD 5HVFB 2KZWA 3T2OA 3V5DA 1TETL 3BAKA 3T1FB 3B8YA 3GPSA 4EI5C 1ML0A 1F4WH 2EXTA 4GAYB 4N3UA 4DW2L 3O0RL 2CR6A 3EADA 3DV6A 4FG6C 4U3SA 5CUSL 4DFHA 3C6EA 3UP6A 1JHKH 2YGOA 5AG8A 1U6AH 3RVUD 4RMUA 3IJYB 3W37A 2OTUA 2FTAA 3GXTA 4L48A 1A3RH 2EECA 2GJ6D 3N6YA 2W60A 3B7TA 1YNKH 2Z93A 4NRXB 3L7EB 1NCUA 4X7SH 4NXSA 4YHPB 2AEPL 1KCVH 3K74B 3PGCA 1KCSL 2YKLL 4JL1A 4LLUB 1BVKA 4KVCL 3K0WA 2PYFA 4Q6YA 3PNRB 4RA0C 2FT8A 5I76B 5KVEL 4JPWL 3TT1H 3GZOA 1SJHA 1ZTXE 3VQ1C 4NQCB 4ZMNA 2NY0B 2UWEF 1M6UA 5AVVB 3S37H 1CBVL 4F3FB 4QO1B 2VNCA 3FT4B 3BZDA 3ZHKA 5D55A 2X09A 3ARDD 2J25A 1RURH 4PS3A 1FVCB 2WY3B 1H3PH 4PJAA 4XZUA 2YO3A 1YNLL 3LB6D 1QI5A 2X9YA 2ZKHL 3EJYD 4K23L 3WLBA 3K71A 1KTRL 4YSCA 3VE0A 1XBRA 3D5OF 5SWZE 3G6DL 1JPST 1J0ZA 4LKXA 2EDJA 1LJMA 2G5BB 3PGFL 3QNFA 4N2GA 3T9WA 3VFRB 4AG4H 2WVUA 5CR8A 2JK5A 5D71H 1FGNH 1O6SA 3VXME 2A6DA 2OMXB 3SKJL 5AZUA 3HG1B 3MROA 5K33A 3E6HB 4PS8A 1KB9K 1YMME 1W0WA 2XN9B 3H7BB 3FN3A 1GAFL 1N18A 3ZXAC 4PLNC 5G4OA 2EDYA 1DJGA 3S96B 3LV3A 2AJXL 1WAAA 1A22B 3O3AB 5JW4N 2JJUA 3BQUC 1ETA1 2IPKA 2BVPB 3LN4A 2XWXA 1ZTXH 2DQIL 4F2MB 3PREA 5BVJA 3V6OA 3H3PH 3OC5A 1O6VA 1VFUA 5D9SA 1EZUA 1H3WM 1TZGL 1X7QB 3SPCA 2JSFA 1MZZA 4TUKH 3ZTDC 1NBZA 4BINA 2WLJA 3QARA 5AENA 3CLFL 4Y16D 3S2CA 4FERA 3ZDWA 1HJBC 7PCYA 5IUSA 1TJMA 3QUZC 4LDOB 3JTBA 3LS5H 4UT6A 1NIFA 3MTRA 4J3OC 4JRXD 5HHMD 3WNNA 4RH4A 3QNXB 5EEVA 1OTSC 1PAMA 3QRGL 2WSPA 1L7TH 4PJ7E 1TPXC 1V3LA 2CO7B 1AGDB 3RY4A 5JYMA 2VO5A 1D6VL 5FYJL 2GIYA 1RZ8A 3EBAA 4NO2B 2X89D 1G0XA 4XH2A 2VLJD 3WOVA 4FG6D 3RL2B 3KAAA 3P9LA 4AGLA 1T21B 5JLZA 3U7AA 4YSAA 4RDQG 3GSRB 4OIFA 3DSFH 4BE6A 4AQ1B 4Z8FL 3NRFA 1DBBL 5FXCH 5KSAB 3BRFA 4ZPVA 5JZ7D 3I3DA 3B34A 4LIQL 3FB7B 2CAKA 4Y2OB 4DW2H 2ESVD 3RIKA 4OLYH 3IM1A 4ICWA 1ZWIA 4PRAA 5CUSH 4FQPA 5K39A 3H42H 2WYIA 5F93C 1ZPLA 5F1KC 4C47A 2ZCHL 1C12B 5KW9L 3QQ3B 1E4HA 3WKQA 1EVUA 4WTXA 3Q8BA 2DMKA 5MEPA 4I3RL 2Z35B 2WUCL 2JF1A 3EJUA 1RUAH 3DX3A 2VJ8A 3ZE1E 3BFOA 3P73A 1IC5H 1SOSA 3B2DC 2AEPH 1E4KC 2J73A 4H7VA 1KCSH 1UXSB 3PE9A 4OUOA 1IILE 4OFIA 4R7XA 3OMAB 3U6RA 1K4DB 3TV3H 1XT5A 2FBRA 1IBGL 1H15A 3DHJA 1NEZB 4XAKD 3L3IB 2C1OB 1UADC 4LEOB 3ZSTA 2WIIA 2VABA 4K8RH 4NBXB 3RGVA 4CC4C 2IOIA 4BM7A 5GGSB 3LQZB 3ETSA 5BO1L 1OB1B 4R96B 4DP1X 4EIBA 1AXTH 3KPNB 5F96H 2WKOF 1TT6A 1D9KB 1H3PL 1A4JB 1JHTB 2ADIB 2ITCA 2QFPA 3E8UH 2F7IA 3RDTD 2DH2A 2VITA 3BGFC 5FA3A 2WWKO 1U8JB 1BFOB 1NL0L 2IFFH 5F21B 3L3OA 3PGFH 1AGBB 3HC0B 4NYLA 5DHMC 5HDBF 4HOWA 4ZNEE 1XX9C 2V33A 1NC2A 2A74A 3BSZL 5CMAA 4N26A 5JPNB 1XCQA 3II3A 5F9DC 3MV9A 4YO0A 1DJWA 1T1ZA 4KUZL 1A6TA 5EC1A 1MHPL 4BFOA 2FGZA 3HHMA 1CK0H 2V4LA 4FLSA 1TTCA 4FFTA 4Y2DC 4Y16C 3FU7B 2AJXH 3NJGA 1L6ZA 3FQ1A 1J1XL 3NCJH 1E9PB 4B9FA 1A1NA 2PR9A 4PJDF 2KC0A 4MGXA 4Z95L 3MJ7B 4ETQB 3SBWC 4O5LL 5CJ5A 4J3OD 5HGDA 4ABVA 5CAYB 5ANMA 3RKPA 3SZ6A 3F04A 3RI5F 2DZEA 1TZGH 4ZO9A 4Z3EA 3W11C 2Q0ZX 3DYPA 1KIUA 1WAAF 4PJ5D 3QEHA 1ETZA 2CE6A 1BLIA 4PHXA 4Q74A 4DO4A 3KBPA 3VFGH 3EG9A 1QAWA 2GSIA 2WQ8A 4AJ0A 2JCWA 3E6FB 2IGTA 2FHFA 1QPPA 3FQWB 5E4EB 2B3IA 1B3JA 4MRBA 1I85C 3FO1A 4NHUB 1DANU 1N5YL 1L7TL 5E70A 1TQWA 2DH3A 2VQ1A 3KPSD 5HHNB 4XP1L 4U0RC 1TNNA 1XGUA 3FRUA 1WV7T 3EIFA 1BHGA 4P5RA 1QLRA 3QUML 1A9VA 2DLTA 3MLWL 4KK8C 1X9LA 5KSAD 3MRKB 1L0QA 3SJVD 4U1MA 1TYRA 3VFWA 4YHLL 1WCBB 2D7PA 1DZBA 3DSFL 3UPRA 1ZT4A 3FONA 3T8MA 4PGBB 4LLYB 5IB1A 1TIUA 1SBBA 2IQAA 1X4XA 2XKNA 3NT0A 1DEEB 1T83A 2FX7L 1SLUA 3CG8A 2X10A 4KKAD 4KNQA 2LE9A 2ZCHH 5JPMA 5F1IB 3QDGA 1LE9A 2EDFA 4CJ0A 4CVZB 2G3NA 4JM2F 3K0YA 1RUAL 4Z7WB 4ODTH 4NQCA 4K3DL 4R7LA 3PDDA 4WO4A 4JG1L 2V3DA 1JMXA 5EU7C 3E3QE 4IKKA 5ETUB 3WO4C 2BSSB 2PO6D 3NN8B 3NN8A 3ARBA 5J1AA 2VLRB 2IWEA 4IBYA 5EEXA 1MG3C 2PW1B 4X80L 1MRCH 3NIGE 3TV3L 1MI5E 3MLVL 4NM4L 4L8CB 5IESL 1UA6H 4TULL 3NPSB 2NY6C 1G9MH 1WD8A 2XBTA 4IBWA 4ZW5A 1AHWB 1QHQA 4JO4H 2MNWA 1LO0H 3FQNB 3LN9A 3VXUD 1QRNB 4F9LC 5KZCB 1OF2A 4RRPG 4Z7WA 2EVGA 2X3AA 2AW2A 4RAHA 4ANVA 4A2MA 3US0A 3KLKA 5JHDD 4NN7C 3UBXB 3V6ZA 2NYYD 3WN5B 1NAKH 5L8KB 2GEEA 2J6EA 3HKZA 1GPOL 1OOAA 4M8QB 1LO2L 4JY4B 1DVUA 9CGTA 2Y7MA 3B8SA 2IBBA 2WLHA 4PI0A 5I5MA 1HFUA 3KVPA 1UM4L 2YD2A 1N59A 1NBYA 2VDLL 2VDRH 2B1AL 3NAAL 4U2YA 3NQIA 1LDSA 1MHPH 1T89A 5E9AA 5H37G 3CXFA 3WS6C 4P2QA 1I1AD 1R3JB 4EIGB 4RETB 4RSYA 1BQ5A 1XH3A 4Z95H 3DX7B 1TUPA 1ZA3B 1Q1JH 5GGTA 4XXCC 3RZCA 3MRBB 3MV8A 2XZZA 3T3PF 1DJSA 4JM2D 2AV7A 2WLLB 1SF5A 3TA4D 3SYPA 3QDJD 4KPHL 1RH8A 2UYLB 2R51A 4X9YA 1VFBB 1YJDC 2XWBB 2DI7A 4APQA 1AIZA 1YPZF 4ZX5A 4M4RB 4BDVB 4N2KA 3VXPA 3EYFA 2YAMA 5IVZA 2R1WB 2F54A 4IS6A 3E1F1 4KJWD 2WXNA 5JHBA 2XA8L 2CGZA 1HZLA 2AQSA 4JFED 1C5DA 4KTGA 4UDUA 3BZEB 1ZVHA 3B2XA 3UBHA 1KTDB 4PS4H 5GIRA 3C5JA 3CN2A 1DBML 1WZMA 2IXQB 1TZOA 1ZLVH 4F27A 35C8L 1K9TA 3GSQA 4KV5E 5IVXE 4LEBA 4FKHA 4U1KA 2BS9A 3SKMA 3X14B 1HDMA 3LQAH 1BXVA 3IJHB 2B9AA 3IJHA 3MGOA 2P26A 3RL1B 5LXGL 4P05A 4ENEC 4AYDC 2EXWC 2G9KA 4W9CC 3H9SE 3P0VL 2F7QA 3FH5A 4HUUA 4OY9A 4N20A 4A6YH 5B7EA 1CQYA 1BXXA 1RD6A 2XG5B 3V7AE 4A2GA 2B08A 2GTZB 3FDWA 3TO4B 3BT2H 4NC2B 3W38A 4YDVA 4K3DH 4X98A 1I7RB 4MJHA 5EOCH 2EKSA 3GTNA 3ME0B 1IGYA 4GSQA 4MA8L 4MB4A 5EOQL 1IEBA 4M8RA 5FKAB 4D8OA 2EVFA 3FQNA 3DX2A 5JW5A 2WXKA 4QOKD 5IESH 4N0UA 5LGJA 1UA6L 3DPBB 3DPBA 2MCAA 4YBLC 4NENA 5LN4A 4JANA 3WFEH 1G9ML 1KXVA 4H40A 3WMQA 2EE2A 4JFSA 2VN4A 1NZRA 1MF2L 2BNUA 2W9DH 1MQKL 2CJSA 2HVBA 3L9BA 2EDNA 2DYPD 3DPDA 4JO4L 4J39A 1LO0L 2BMKA 3HE6C 1FVDA 4UILH 3TO4A 3VGGA 3G5VA 1VFAA 4JQVA 1ITCA 3VMPA 4OUUB 4MJIA 1ZJAA 4MD4A 5I1DB 1KTKE 5K1JA 4LLAA 1KYDA 3B5TA 2LTQB 1B9ZA 3ZX1A 3GHPA 1BZQK 1YA5A 5I1HL 4C56B 5FO9B 2ARWA 1LP9B 2VDLH 3QCVH 3I50H 1P7QB 4O2CB 3WTWA 1M7DB 3KVQA 1V05A 1K4CA 4JHVA 4KC3B 5H2BB 1AQDB 3LZNA 3LIZL 1XDTT 1UJ3A 2ZX9A 1P84J 2OPCA 5T3XL 1SXCA 4Y1AE 2O1AA 3ARFD 3GSNA 1ET5A 3OKKA 2QHLA 3V9EA 1OD7A 3AAZA 4RX4D 4U1LB 1E67A 4WQOA 3LH8A 1HTYA 3D08A 5T1LA 4HD9A 4JN1H 5IROC 4MFHA 3KDMB 3CHRA 2IVFC 1QFPA 4GSRA 4CMHC 1Z0MA 4QHNA 3HRZA 2YLHA 2BHFA 2MMXA 3WHXA 3GDBA 1IIKA 4M1GL 3T3ME 3C12A 3TEXA 5LWYL 5DFVD 4NQQA 3CSPA 5KYWB 3QJFA 1MCQA 1UYWH 3HN3A 3WFDL 1RFDH 4AMWA 2NZIA 3TURA 4YL9A 1SEBA 3TA3A 4S1DC 3C60C 4NRZA 5INCA 3VG9C 4PRNA 4KZEH 2OJ1A 1G7QB 4K07A 5AVWB 4XODA 4XAWL 2XV3A 3UZVB 3UZVA 3CX5K 2ADYA 2XBZA 3SE8H 5CILH 5HYEA 3DRQA 3BW9A 5DRNA 4M7ZC 4WO4C 5CJQH 3C6LD 4JS7A 1M6OB 4BSVA 1H19A 4NFCA 5E2UL 2V2XA 4MBOA 2UY7A 4CADA 4ENED 4U3XA 2Z34A 2WIMA 1B4JH 1DBMH 4P57B 4YQXH 3CK0H 3G5ZB 4S10A 1D5IH 2CUAA 2X6CA 3GI8L 4HALA 2ODIA 1S7TB 2X6AA 3CU7A 3BI9X 3PWUB 4LSSL 4YOKA 3DIDA 2CBOA 3REVA 1MDAA 3D2UA 1XMEB 2GVYA 4F8LA 3HG1D 3QH3B 3ZT5A 2YFNA 1AGFA 3BPNB 4B9YA 1DSYA 3MGAA 3LKRA 4YXHH 5AOIA 4V1DE 4A6YL 4JDZB 2WVVA 3FCSB 3B5GA 2B9BA 3GSOB 3LZLA 3C87A 4L4VB 3DHMA 4YHOH 2FT7A 5CIPH 4LSVL 4GINA 3TYGL 3BD4A 2E7MA 4XWGH 1PLBA 2YBRA 4BE5A 2VW6A 2VUKA 2K45A 3BUIA 1MVFA 2L3BA 2IOOA 3UCQA 4RWHA 3S3JA 2ZOKA 1WEJH 3BGFB 1FNSL 1WITA 1THAA 3ULSB 3ULSA 2QDWA 3DMMA 4AEFA 4RX4A 2GJ6A 2GJ6B 4N90E 1W72L 1I3RA 3PDGA 1MHEB 3I75B 3OXSA 1SJEA 3UP1A 3O45A 4TSAH 3WFEL 2P9RA 1UQSB 4R97B 5I5RA 1PZDA 3X3FH 4CSTA 1MF2H 2YGNA 3IJ9A 4JR9L 4I2XA 3BP6B 4LCCB 4HKJB 1N4XH 5F6HI 2XOTA 5TK4A 3SDAB 4FX5A 1F3RB 2OR8A 1TYJA 3ZZLA 3DO7A 3T8VA 1Y0LA 1TMCB 2OMZA 1OGTB 5I18H 3OWRA 3V4UH 4PJ9B 1EV2E 1UB5B 5B1CA 2EC9U 1FV1A 4N24A 2VDOL 4XPBL 1HINH 3G6JF 3IKKA 3T3MF 3ARFB 1SJXA 3KYNA 5ERWB 3TCTA 4NBZB 4RIRA 3HZVB 3WNIA 2VERN 5JO5B 3TXAA 3QCVL 1AGDA 3I50L 3X1FA 4LVHC 1C12A 4WFGD 3LMJH 3JWOL 2BWIA 4OIAA 3UEZA 4CRPA 5T3XH 3BLPX 2E4FA 2OJZH 5E9DB 5EIVA 4PMEA 1J86A 3QORD 3DX8B 4LL9A 1YEFL 4AQAA 4G42A 1UD5A 3DUHA 2LW3A 3TS8A 4FEIA 4MNQD 5DT1L 4KVNH 2N59A 4IBQA 3CZFA 2YMOA 4NQUA 1GOGA 4N9GA 3U6XS 5GJSL 4QIRA 4M1GH 1NGPL 3WE6B 3V10A 1CL7L 5EB9A 2J55A 3GKWL 4NJ9L 4PR5A 4Z7UF 2ZNWA 3VFMB 5GZNC 2IV8A 3ASWA 4XAWH 4JO5A 4I9WE 4LSUH 1SFHA 5HJDA 5FW7A 1NTDA 1NCOA 2NY3D 1KPUB 3IVKA 2NW2A 3CUPA 3CUPB 3APFA 4GQZA 4QTIL 2PKDA 1GTFA 5E2UH 1Z9SA 2VQ4A 2W38A 4MCMA 2WANA 4MA3A 3NSYA 1DN2A 1JZJA 5BS0E 1D9KD 1KN4L 2G2RB 3I9AA 3V8OA 4XBEL 2DKSA 4Z7NF 1J8RA 2CQVA 3C6SA 3CXHJ 5ECJE 2GSMB 4ZOCA 1HWHB 3N85L 1M7XA 4XNDA 2C9SA 5E94B 4GUCA 4JY5H 3WMSA 2DN7A 4PJCE 4AH2B 3U9WA 2OMUB 5IOKA 3N1QC 4G71B 5B1BB 2BRQA 1H6EA 2WLIB 2XVGA 4A2FA 5ALBL 2DLIA 2R4RL 4PWJA 1CC3A 3ZPDA 1W0VA 1IT9H 4E41E 3KPMA 4YXHL 2E5EA 1BGXH 4KAQL 4M7JH 4I9XA 2C9QA 2YPKB 3KXFB 4HBQA 3QIBA 4MZ3A 2HXAA 4YHOL 5I0YA 5FYLL 2RACA 4LSVH 3P11H 4XWGL 4PRPD 2X4TA 2DDQL 5IM7B 4J12A 4GUOA 1JTPA 4X4KA 4Z0XA 1EAOA 4PIRF 2H1LM 2Z1PA 5GRVK 1MY7A 2GTWA 3FMGH 1ZGLM 4Z3JA 4LSPL 1FNSH 2DJMA 5ICXA 2Y6TE 1XB8A 4I18A 1DUZB 3ZE1F 3ZL4L 4UB0L 3AU0A 3OKMB 4KTYA 1P1ZB 3AABA 3VXRB 5DO2D 3QIWB 2PTTB 2VR7A 3TVMB 3B9AA 2ZKYA 4EN3A 2R1XA 2P80D 4X6EB 3E9UA 2AMUA 4MJ5A 1ANUA 2APWA 5EUOB 5IW3A 1DSWA 3PQYB 5BVPH 1M9WA 4O02B 4UQ2A 4G6JL 2OZ4A 3FRPG 3FSOA 5L7XH 4ELME 4UQ9A 2E7BA 4JM2B 1XZWA 4UOJA 1A9EA 4NJAL 5DK0A 2VJXA 2AV1B 2DTML 3FTSA 2OMNA 5EEWA 5E9DA 5IEHB 1A0QH 1NJ9A 1S7VB 2AEIT 2CK2A 3O4LB 2ZTBA 4WI4A 3TZVD 2B1HH 2X6UA 4ADGA 1A4BA 1FL5A 1HQ4B 1MELA 1I9IL 1R75A 3LMJL 4MNQB 4S11A 5E5MB 3AY2A 1T4KB 3JWOH 1XR9A 5E08H 1RK1A 3TWCH 3ARXA 3LXCA 3SE9H 3VXQB 2CGRL 3ZHLA 1AR1D 2OJZL 3R06A 2GJZA 1A14L 2ZCLH 4G1MA 2R23A 1H6UA 4NQTA 1YEFH 1QSFB 5AZ2H 4U6VH 5IQNA 4FA6A 2K4WA 1XGTA 3FU3A 4OLEA 2APTA 2A1WH 1T1YA 5GJSH 2EIBA 2WO3B 3T6WA 4LLYA 3PAVA 1HKLL 4QRPB 2DI8A 3TEYA 5C09B 5MENB 4S2SA 4W4OC 5TFSH 4PSRA 3BISA 1PYWB 2P5PA 1HILA 2RGSA 1E6JH 5I82A 4B9CA 1IRAY 3MLUL 1RIHL 3CFBA 4FNSA 3BVWA 4ZTOL 4UOQA 1FZJA 4AUJA 2Q76A 3ETBJ 4W70A 4FZEL 1NGZA 1NGZB 3D7PA 2CJTA 1X7TA 3BH8A 4NUGH 3GDCA 3QWOA 1UH2A 3L5IA 2AZAA 2COQA 3MBWB 2CBQA 1PY9A 2I7SA 4LLVB 4WU7B 4XPFH 2G60H 4DETA 2R1YB 4AVJA 2QSCH 4FHBD 4Q8BA 4G8IA 2ZXAA 5LQBL 2PP9A 3LN5B 4HJ0D 1AQMA 2X4RB 4LSTL 3D4ZA 3ZMEA 4NCC1 4HFWA 4KK6C 2F18A 3WYRA 3JUYA 3MHZA 3PHOA 4QXGL 2X4TB 3LNFA 4PTUB 3QCTL 3HMXL 1NBCA 4Z0XB 1E2ZA 4IHBA 2FD6L 2W1NA 3KL5A 3SDXA 3RY6A 4M7JL 3D6GA 5BQ7B 1J8HB 5J4MA 3BCFA 4J8RA 3AB0B 2WK2A 2XIBA 3FU7A 3MBWA 1Y6KR 3M1BA 5KVDH 5IV2A 1Q8MA 3S3CB 3C9NB 1EAPA 4OCMC 1BA9A 1C8PA 2HT2D 2ARJA 2LU4A 1DL7H 4WI9A 2P5WA 5E5RB 1BFOA 2RA1A 3NCFB 1JGVL 4LASH 4TSBH 3FMGL 3QZOA 3MQIA 3N1MC 4MKTA 2HLFD 2YEVB 3E80A 1M2VB 1SGKA 3CSYA 1V5JA 5AW9B 3D0VA 3HNSH 3IKCA 2VXVH 1H0DA 3V0DA 3O3EA 3ESVF 4DSYA 4KUCD 5KVEE 4PJEE 5KJ4A 2ARJQ 5D7SL 5DHVA 2NX5E 3GSVA 4TTDC 4FKKA 4FQ2L 2D7MA 3HW7A 4IU2B 1A5FL 2Y3AA 2ZYRA 1NMAH 3FUFA 5GSRA 4LCYA 4G6JH 2RIKA 3P3YA 1CGTA 1N9PA 3JWNE 5L7XL 1CT8A 4M7LL 4PRBA 4DPCX 1IUZA 3LHPH 4AI7A 2F53D 2VXSH 2FL5A 1YEHL 4WGWB 2YAPA 4OZ4A 1EEUA 2E9WA 4C58B 1MAJA 3GJEA 2EVJA 3WKMH 4KK5C 1KPRA 2B1HL 3SDXF 2VW7A 1T20A 2QFRA 3LOWA 2HYMA 4OGZA 3SGDH 3TBYA 1ZANL 1HYRC 1V3JA 3DTDA 3WFCH 5E08L 1MZYA 1P7BA 1QW9A 3POHA 2XACC 3MR9A 1FZKB 3VU1A 3EH3B 3Q1SL 1SXBA 4NLHA 3BVDB 4NPYA 2WM0A 1A6AB 4LCWB 5AZ2L 5EIIA 3D18B 1OSZB 3MNWB 3V4VL 5F1NA 2ITDA 1WC7A 1JZGA 2X28A 4GG8B 1MSPA 1QFWL 3MBEA 1F4YL 4WEEA 2VKWA 1RPKA 2ORBH 1UM5H 5IIEA 5JIMA 2VZTA 5DYOA 1OKEA 2GYSA 2X38A 4KXZI 2Y7QA 4HCGA 5DS8A 4KY2A 1E6JL 2IAMB 5FGBC 3MLUH 4XNZB 1K4DA 1D5XB 2LV4A 4XP6H 5F72S 3S7GA 4P49A 4E9VA 4QJ3B 3ROLB 5IJCC 3A5VA 1DVFB 2WC7A 3FF7A 3U0TA 4MDJA 3HBZA 2R83A 3HRZC 3PWPE 3C5ZC 1NCWH 4NKQB 1A6WL 1S7RB 3HNVH 4XO8A 1ZLVK 3S3BB 2E75C 1VZHA 4OD3L 1F11B 1CYWA 2Y5QA 4N2HA 5AG9A 1JF1B 4KJQD 4XPFL 3IDIB 1BFVL 43CAB 1U8QA 4G9FD 3P2BA 4JO1H 1XXDC 4NQED 2J8UB 1W0VB 4YDKH 1C1EL 2YSTA 2NNAB 1TTFA 2CRZA 3V5KA 5LQBH 3CIAA 1S7WA 3OKNB 1HCVA 4LSTH 4OZFA 1Y6MR 3QDMA 4L9LC 3FSZA 1ZLSH 2WP3T 1FNFA 3EO1A 2JKWA 1KB3A 3KGRA 4HXBL 4P3DA 1QSZA 1ZA6B 2FGWL 2PETA 3OLIA 2E9IA 3QCTH 3T4YB 5HPOA 2FD6H 4X6DF 1K8DB 1VCAA 4YGVB 4X6DE 5FF6A 5EN2A 4Q9QL 3I3BA 4MX7A 3NIGF 1BMZA 4LCUB 1P5VB 1R5VA 3L4TA 2EE6A 4M6NL 1LK3H 4R5TA 3ZYZA 3KPNA 4MCZB 1YN7A 2FJGA 1JHTA 2ADIA 5LBSA 3SCMA 3DUUB 1DL7L 1PDKB 3MI6A 3WEAA 3U83A 1Z3RA 3AS1A 4QKXB 1WGOA 4XMLH 3T2LA 3G3LA 4ZJ9A 4NWUL 1DLHB 3W9DA 4MAYC 5DJYB 4LPVA 4PGCB 4A1RA 1JPFA 4M8QA 3U25A 1B0GB 4XNXH 4DP0X 4HKXA 3HR6A 2IH3A 4W9LC 3HNSL 1KC5L 4Q9RL 4LP8A 4GXUM 2R2HA 3SBPA 2ZP8A 2LFGA 1IGIH 1UOVA 3DUSB 4MZRA 1S7QA 3UTSB 1EXGA 1B4RA 3V0AC 3L1FA 5D7SH 5EN2B 4IRJC 1PKQE 1KDIA 1CBJA 3CBKB 4NNYB 3V52H 4NB7A 4NDMA 2XC8A 4YK4C 4KI5F 1A5FH 1L0XA 5DJ2B 5H94A 5JA9A 4XP9L 4KI1A 4HGWA 2PYFB 1AD0B 2EH8H 4N0YH 3ZTJG 3N41F 1KGYE 3OAZH 1YEGH 2VYRE 3QYCA 4JVUA 3L2NA 4U0QB 7CGTA 2DWSA 3LHPL 3QI9A 6PAZA 3NFSH 1UM6H 1IKFH 1YEHH 4MNGB 3GRBA 4I0PD 3TA3B 2PPEA 5INCB 3FQ2A 4KMQA 4GNKB 4EUPB 4EUPA 1FJ1B 3Q2LA 5DDHB 2XWTB 3QULA 2VUOA 3QUMB 1FZOB 2QELA 4HIPA 1OSEA 2EAEA 1ZANH 5HHPB 4QOKB 1YNTB 4BQ9A 4P2RA 3GXMA 1RJZB 4N6QA 4P4RB 1YY9C 2VC2B 1YAZA 5DA4A 3MUJA 3VFRA 2J1ZA 4FQJH 4BFFA 4AV5A 1JGLH 2FO8A 2IIJA 1ACCA 5DYOB 4G6FD 3V4VH 3R4DA 4FXKB 4GP5B 1XIWB 3DRTB 3A67L 4L3EB 4R7VA 4XVSH 5IG7A 4LEXL 1I7ZB 2FQFA 1EZVX 1QSEA 2NW3A 1Q4NX 6CGTA 2YD3A 1QFWH 1QOKA 4HAKA 1UWFA 4F5CA 4LOVA 2MCG1 2HTLC 4MXVE 5DURD 3G6JB 1HT6A 1M53A 4AT6A 1HSAA 3GBDA 5M7QA 1JZ3A 2OXGB 3V0VB 1HCZA 1O75A 4B96A 3ZHFA 4Z7VF 3CXHK 4AEIH 1JJUA 1W0YT 1QBLL 3ZGHA 4LLUA 3NIFE 1XF1A 2J8UF 4JHBA 1IARB 3HE7B 4YXKH 3KYKL 1RL1A 3FQXB 4QWWD 4YVNA 1N8ZB 1BECA 1AZUA 2QADB 1A6WH 2RB8A 2BIPA 3HNVL 3HZYB 2BNUB 2VAAA 2Y6SD 4B95C 5JORB 2IANB 4OD1L 1J9TA 4OD3H 1R9FA 1OTTD 3AQXA 1IQDB 4AE0A 1S9KC 1U33A 1CICC 1NWPA 2PF6A 6TAAA 4JRFA 5HP5A 3QUYB 2ALWA 3K6IA 4FYQA 3FU6A 3VTTA 1IBYA 1F6AB 1H8OA 3V0HA 3VXUA 1PW3A 4PJ6A 3DC0A 4H8QA 1WS7A 2VN7A 2BP8A 3EJSA 3LH9A 4S0TD 5I19L 1A21A 3QJVB 1DYZA 1OPOA 1QSFD 4YIQA 5D7HA 2ZOWA 3JTTA 4G5ZL 4CUCA 2FGWH 4QXWA 4X7DC 1U0QA 4XNMA 2BLFA 3NEEA 4PWIA 2WBXA 4LPUA 4ZUWB 4MAYD 2OMVA 3SGEH 1G84A 5EPMB 4XVUC 3RPIB 2ZYSA 1MAKA 1GR7A 4UM9A 3RDTA 3MV7B 3WD5H 3C6LA 3GK8L 1M2VA 3F7VA 1FL6A 4QHKJ 2YXVA 4CC0A 1LD9A 3MNMA 1XZ0A 1CIUA 5FV1L 3MRMA 4P2RD 4FHKA 3N42B 1NCHA 4TVPH 3VWJA 3CXDH 2ZWLT 2C8NA 4NWUH 4GB9A 3SQRA 1SXZA 1XQ4A 3CZEA 3VH8A 4KRPD 4LLQA 4XNXL 5HDRA 2EEFA 1BYPA 4HK3N 1C16A 4J3OG 5J89A 1IAIL 3WTYA 4JDTL 4GRWH 4UZUA 1WBZB 1SUHA 3FT3A 4JFEB 3OLGA 4XHJC 5DGRA 3V52L 3IDGA 4UZGA 1KLFA 3BGMA 1G7QA 1MEXL 2APSA 4AL8C 3IJSB 1OAXH 4RMWA 1GZHA 4JJHA 4XCYA 5EOTB 1B0RA 3VMOA 4J2XA 2W60B 1MCBA 2HWZL 2JCCF 3S36L 1NCAL 1IC4L 2D0FA 5EU3B 1ILSA 3BZ4B 3IU4L 5KJRH 4U1LA 4DGIL 5F88B 3FU5A 3C8DA 2RH0A 3KR3H 3VG0L 4UQDA 4AGMA 5E2VH 5D8JH 1RLBA 1WISA 3X11B 5F1SA 3UDWA 1G6RL 3T0DA 3F8UB 1I8IA 4HJGB 5MHSE 4N8VA 3VJ6A 4M1DL 1UOLA 3SE3C 3P73B 2J5LC 2Z4QB 4GY4A 2WCSA 4CBPA 2BDNL 2QKIB 3B2VH 3E3QC 3OXRA 4U1MB 1NFIB 3BYYA 4FQJL 1EIBA 1T7YA 3QZWA 1U3HD 1JGLL 4PRHE 4PWGA 1KJ2L 4WDIA 1PLCA 3K80A 4GRWE 4FA7B 2PCPA 5DJ8B 3A67H 1DHKA 4XVSL 5DK2B 5FK9A 5C6TL 4HYTB 4MJIE 2QZQA 3DX9A 1KEGL 4JFXB 2NNFA 3NCMA 3QQ9D 5IF0B 1I9EA 3BDXA 5JW3H 1YUKB 3HE7D 5GS2D 1BFTA 2EDDA 2CIIA 1KGJA 2V5RA 3Q6FA 1J18A 3B5HA 1Z5HA 4P5TC 1RERA 1CICD 1T1WA 1BQUA 5EWIH 3ZSSA 3NZSA 4MA3B 4AEIL 1NFKA 1HSBB 1NGYB 5FLUA 5FEBA 1L0PA 1JPGA 1J1PH 8FABA 5GS3A 3FN0L 4HUXB 4ZS7L 1OGPA 4NZFA 1KYAA 2QQKH 2P44B 4L29A 4TNEA 3IYLW 2Z0UA 2QVMA 1S7VA 4HJEA 4M4PA 1BIIB 2H8PA 4MNHB 5EU7E 4P23C 3MX0A 3TPKA 3WY1A 5SWSB 1A3LL 3RWDB 2GFBB 3QWRA 3KGSA 3RJDA 5IQMA 1FIEA 4HKBA 3CSFA 5LGHL 3JVGC 4HOXA 1R5VB 3P4OA 4PY7B 5IBUG 5TGBA 2ZONA 4QXUL 5I19H 4QTHB 1DO5A 4MJ5B 3O6FA 5AVUB 3UMNA 3IT8D 4OGQC 2F53B 3HC0A 3FYEB 4LVOB 3IMUA 3ULUD 4B50A 3BWAB 4XN2A 3OSKA 2EO1A 3BX7C 4JGUA 1KIRA 1UEYA 2JJSC 4GO8A 4YAQB 5D1QA 4HAFA 2FE0A 2HVKA 2NY5H 3DROA 3O4OB 4FQXC 5E1QA 3RL2A 4OZIB 1AFVL 1KNOA 3UCRA 2TAAA 1I9RL 1U41A 4URTB 4DEPC 2VDRB 4QAMB 2I69A 4WKZB 4YHIA 3HVNA 1S6NA 4LKCA 1OALA 1NBYB 1DEEA 4UQBA 2G3MA 2R2BA 4TVPL 4LLDB 2WXFA 4UT6L 5TJWK 1U3NA 3NIDE 1TLKA 3MRNA 5E4AA 3V5DB 4AQEA 3LRKA 4OJYA 1MUJA 3Q7JA 3KBHE 3PHQB 1IAIH 1J05A 3F01A 1HXYA 2VMDA 2HT4C 2OYMA 5B39G 1SDDB 1C5BH 5FM8A 2HFEB 3QJOA 4H1LA 2G9HB 1MEXH 3ARWA 3LRHA 2XY1A 1BZEA 5MEPB 3S36H 1IC4H 1RIVH 2PWFA 3FO1B 4BD4A 4DGIH 3W0WD 2VQ1B 3KR3L 5IHZB 1SLXA 2AFNA 3VFPB 3ZKXC 5D8JL 1W72A 1WWBX 2IG2L 1FGVL 1G6RH 2Q9OA 1FVEB 4Z1PA 3P77B 5KG9A 4ZPVB 3HI1B 4E9SA 1JXDA 3VXSB 4YLBA 2OTWB 4M3HA 5GS1C 4ECNA 4OCYH 2BDNH 1GYWA 3ZBMA 2GBUA 3WNOA 4QGYA 4DO5A 4J8QA 3NH7H 3V4PB 1RPUA 3MACH 3BD5A 3QEQA 4TQIA 2VISB 4MJJA 3U9UA 3I6LE 1W16A 5IFHL 5L8LB 1UZGA 3BN9D 5F71A 1JYXA 2VXUH 3CJJA 4HJSA 5GZOD 1TZHA 4P0DA 3W3BA 3KYOB 1BQRA 3US1A 1KEGH 3KLQA 3QXUA 3AUVA 4TVUA 1BZ9B 1M1XB 1T0NA 1YEDA 2K3HA 3OKEB 3PJNA 3VNYA 5J3HD 1YECH 4KO7A 5A7BA 1HHIB 2MQCA 2NY4D 5EWIL 4ZFOL 2DYSB 3DNKA 2DQHH 5J1AB 1YPZA 2X4NB 3AFLA 1GL4B 3MGTA 4IHOA 4U31A 4R4FH 5HYJD 4G82A 3HOGA 2XN9D 4NZUH 5I30H 2GFBA 1TFHA 2C9RA 1K85A 2QQKL 1FZMA 3EO9L 3X12A 4JDZA 5E2JA 5BZXA 4PJBF 4O2EB 4LAQL 4IMKA 1B3IA 3S5YA 4UQ2B 1LEKB 1U8NA 1INDH 4L9DA 1UH4A 2V17L 1A3LH 1G7PA 1ERNA 2HAZA 1NEZA 3KPPB 4NN5B 3OPZH 5FO2A 2Q3XA 5IJDC 1HYSC 5KYXA 1Q9KB 3R19A 3APDA 4FGMA 2VIRB 2RD0A 2YD9A 1F0LA 1OE1A 1UD4A 4R2GC 4FXGA 4ZFOB 4GQPH 1S78C 5C0CB 1KT2A 5I1CH 3DHPA 4V2BA 2X7LB 3NEXA 4LVEA 4I85A 3GXPA 4EF3A 4ETQA 5I8CB 2PW2B 3ZDZE 1JIBA 5JQHC 1SFDA 3F00A 2NY5L 3D12B 3WL9A 3NDZE 1AC6A 1AFVH 3DETC 3TH3T 1URLA 3UTQB 8CGTA 4I9WD 3OAYH 3FKUS 2YMXL 3QS2A 4IIQC 5CSZB 2XPGA 4I88A 5IY5B 2OZ4L 2PXYB 3HB3C 4XMTA 2B39A 3ABLB 4GW1B 2JV6A 4JDVA 5C8JA 4JG5A 5D7IB 1KFGA 5I8KH 4QHKI 1S3RA 5IB5B 2DYPA 2P42B 1WFJA 5DHVH 4P9HH 4ANKA 3KLHC 3QUXC 1JPSH 2P4AB 1XIWD 3U7WL 4Q6KA 4QYOA 4ODXA 1DCLA 4XXDA 4JDEA 2PPAA 2SODB 2EEDA 1OM3H 5IGXH 1GTNA 2ESVA 3EYQC 4JE0A 5FS5A 4XH2B 1NMBH 1U3HA 4HIJA 3VWKB 1VB9A 2ZWSA 2JKXA 4YSQA 4QHMB 3VSUA 2AK4B 2EE3A 3F6IA 3UAJD 2AEQL 3MFFA 3NJHA 3NRQA 2EDKA 1OM9A 1J48A 1IJNA 3EGDA 3EGSB 2IG2H 4L4TE 1FA4A 1D5XA 4XNQB 3WE6A 3SIKA 4LBEB 2CLZB 3SE4C 5GZOC 3PL6B 4JFQA 2BSEA 4BSVB 4NM8L 1GKEA 4FP8L 3F85A 4K3HA 3D18A 5EIIB 1E90A 3KJ4B 2K4AA 1X5LA 3WN5C 5JHLH 4F8OA 3MACL 2OXHB 4YLCA 1I85A 4NCC2 3O0RH 4A37A 3S35L 3WXVL 1LP9A 1RK0A 2DM7A 2VITB 5ID0B 4UIKL 2P1YA 2F53E 5AOMA 4MB3A 1U6AL 1X5MA 3JUZA 4A2EA 4BK5C 1SQMA 1AGBA 3D48R 5L2KA 1MQ8A 1Q9LB 1D5MB 4KXZH 5F7FA 1QFWI 4AIEA 1NICA 1YECL 4PGDA 3NBNA 4K5NA 2IXQA 2E6QA 4G9FE 4QRSA 4JFZH 2G5BA 2E4TA 2YKLH 5B3JE 3IGFA 1T03H 3FO0L 2F54D 1ONQA 1ONQB 1BAFL 5D1QE 1U8NB 4R4FL 2BY3A 2V8MA 1HYSD 2NY3B 4M9OA 5I30L 1OL0A 4NRYB 3BAJA 1T6VN 2AMGA 3Q43A 1AG0A 4XPTL 3EO9H 4N9OB 1CE1H 3T6QC 1CBVH 4IBVA 3W9DB 2NXZB 4GIPD 5EU5A 4JKNA 4AM0Q 1SMAA 4OBRA 3MLTA 1YC7A 1G7IB 1TQBC 4KH9A 4PJHA 2LGNA 3RUGF 2ZKHH 3K1DA 4TQ8A 3UO1H 3OPZL 1E27A 4J27A 2FVNA 3DJSA 1P4LA 5CGYC 1X7QA 3ATAA 4QGTA 3VFTB 4AG4L 2FQGA 3DJZA 2F54E 2W65B 4MCNA 1NBQA 3HB3D 2FQEA 5I1CL 1T0MB 1WYJA 4LE8A 4XO3A 3B1TA 4UU9A 4XN9A 3WEXA 4XOEA 5A7EA 3DXAE 2AERT 2CDGA 1GAFH 3H2PA 3KYNB 5CS7A 4PRNB 1LO5B 5E24E 2Q6WA 2JKJA 5LBSH 3UG3A 2YMXH 3LKNB 1FRGH 3NYKA 1O7SA 2MWCA 2OZ4H 3BKYL 3UZEC 2DQEL 1RUQH 1F1AA 3H3PL 4NIYE 5E7BA 2V5SA 3N55A 4TQHA 4LSRL 4LIQE 4TUKL 1OOWA 5DC4B 1IU1A 5IJVB 1L5GB 2FYVA 5DJ6A 3CLFH 2O6EA 1CFTA 3FAWA 3Q06A 4K5MA 2WOYA 4W81A 2M8XA 3U4AA 4P9HC 5KG9B 1S7TA 4BK8A 1NMBL 4B9KC 5IK3A 4ZMZA 5HHMB 4GEJA 3EYSL 2WVTA 1AQDA 1UUSA 2GY5A 2Z7UA 2X4OB 1FNEB 4KGLA 4F7TB 4WI5A 1D6VH 3LXUX 1NAML 2G0KA 3C75A 1J9SA 2YHGA 4PWEA 3V8CA 3OD3A 2ITDB 2YFOA 3NSFA 5CKAA 2NSQA 4QRPE 4YHNB 2A7BA 5JNYB 2V7NB 1AYOA 4WTZG 1FAIH 4WTQA 5DZAA 2AGJH 2O61B 2EDQA 1G7JB 4OCSL 4NM8H 2OMVB 1XF5A 5I0WA 2A6DB 5FO8A 2CR3A 4JREB 3AG1B 3VGEA 1U8KB 2CLRA 4H8WH 4EDWH 3IDJB 1DBBH 1BFSA 2XN9A 4NAMA 4LIQH 5JIPA 1KCKA 2EXYC 4XRCA 1CVRA 3WXVH 3HZVA 1G7MA 4GBXD 4KKCC 5J6HB 2EE0A 4DKTA 4F91B 2EDBA 4PJAB 5KW9H 4K4KA 5TH2A 5JIIA 3QQ4A 4MQXC 1J8SA 2QDVA 1CDIA 4LLVA 4HJIA 3NQKA 4I3RH 4WU7A 5HJGA 4QTFA 2WUCH 3TA3D 2I5YL 2MOGA 3HFML 3P02A 4L8CA 3MLSL 3HZMA 5JZ7C 1IC5L 4WFHD 1A6VH 4G8FA 3UDWC 3EH5B 1KCLA 5I76A 2IEPA 3QRBA 3V95A 3ZVVA 4JFZL 1N3NA 3FO0H 5IMOB 9PCYA 2PTVA 4URKA 4H2AA 3ZR6A 4W68A 1IBGH 3QJUB 3VI3F 3G04B 5D4QA 3GTTA 2OMTB 1LVEA 2XQYK 1I1AA 2AXJA 3VXTA 4XPTH 4UCFA 1CE1L 2H2PC 1SN2A 3KJ6H 3QFJE 3EOTH 2HB0A 1GIGH 1D5ZB 4NZJA 3KS0H 2O5YH 3L6FA 4ZXBD 2JKRM 4TUUA 5F96L 5B8CC 4U6YA 1IZJA 3TBTA 3E8UL 2Y69B 1E8ZA 4X9GA 3KYAA 3UBFA 1FIGH 3HZMB 5D1QD 5AW1B 3N5AA 2WINB 2MQ3A 3GMLB 4YDNA 5BRZA 3ZTNH 3FUDA 1WAPA 4ZUWA 1M9SA 1ZOXA 1LK2B 4AKPA 1WAEA 2CPUA 3SBRA 2KI6A 2NCEA 2OTUB 3ROOB 1JPFB 2NNCA 4Y9FA 4CN4A 4Z7NB 2JCCA 4Y9EA 5C3TA 3QEQE 3ULUL 3PIQA 3BSZH 1T5XA 1YNTA 3RVXC 4F92B 1JGDB 1O6TA 5K5YA 3T3PB 2PYED 3L1GA 4EZLA 1CK0L 1ZIBA 2J1WA 3OBAA 2YOAA 4QRBA 1KIPA 2H3KA 2X9WA 3UGXA 2H3NA 3ZKND 3D39E 4Y19B 5LBSL 2FB4L 5EBGA 5AW7B 1ZHLB 2P5EA 1FRGL 3DDFA 2I07A 2JELH 3BP5B 3ES6B 4HJUA 4JKPH 1RZKH 2A6JA 3JWDH 4K7PX 2P3YA 2VLRE 3BKYH 4O5LH 4PPTA 2Q7YA 3O6FC 1RUQL 1JGIA 2BRRL 5HYJB 3SBWA 4QF1B 2DBJA 2BHZA 2V8LA 1HHGA 4LSRH 3BKCL 5DEFA 1AIFA 1E9OA 1B2WL 4GBXA 3AROA 1S7UA 3AACA 4N25A 1KZQA 3HCVA 2FCBA 1U91B 1M71A 3BW9B 4LDEB 4QCIB 4KKLC 3ATDA 3DX7A 3DBXB 1Q9WA 4XBMA 3ZE1B 4WHYG 4ORZC 3B37A 3EYSH 1CF1A 3GUTA 4JZJC 3EO0B 3EO0A 3T65B 5DHYB 5G5DA 3DVNA 4H25B 4P4KB 3OVUB 6PCYA 3IVKB 3QUMH 3QDAA 4UNUA 4APQB 3EJCA 3MLWH 4U7MA 3BZFB 3JZ7A 4HISA 4KKCD 3ALXA 3QW9A 1FAIL 4GI9A 4GRLB 2BXZA 4XPAH 1E9OB 3EHBC 2XCMC 4N9GB 5DZVA 4KX9A 2CCVA 4TQPA 2I25N 1KJ2B 4PP1C 4KZDH 4H8WL 1FHGA 3TA3C 2CHNA 3P0GB 4P2YA 1CE6A 5FGBA 4BQBA 3C2SA 2FEEL 5DQJB 3BSZA 1KACB 4WHYH 4PGZA 5L2JA 1F18A 3B9KA 1CFNA 3IWVA 3FTZA 3NZ8B 4Z7QF 4Z7OF 3MO1A 3O11A 3FB5A 3H9HA 1GY1A 1JF1A 1RMFL 3VX0A 3SPIA 1DQQA 3L17A 3HFMH 5D5MB 3QJZA 3EJRA 3D34A 4ODTL 4X8XA 4QHUB 2WZ5A 4ZG1A 3VFNB 1JF5A 2VLKD 1D6EA 1EXUA 2Q8BL 2CUIA 3L4VA 4M6ML 4X6FB 3RX7A 4YNYA 5DMGC 5LUMA 5EZOL 3BO8A 1EHAA 1MRCL 3REWB 4W9JC 3QXDB 1ILUA 3MLVH 3S4SA 4WY7L 3PY9A 2P24A 4NM4H 4Y4HC 5EF3A 4IBTA 4PG9B 4PG9A 4E5XG 1H9DA 5HDWA 3PWLA 4KWUA 3ZDXF 2R0LL 2RFXB 3I9PA 4K3EL 2HG0A 3RGBA 3KJ6L 3EOTL 3BEVA 1GIGL 1U8PA 2EACA 3CZKA 3F64A 4LZKA 5FUCC 5C07D 1UD8A 1EUUA 1R3LB 4JFFD 3ALWA 1KFAL 4Y2OA 2QVKA 4E0RA 3CD4A 4RA3A 4DIXA 2B2XL 4PYHA 4HUWA 1E65A 1HIML 3QZPA 1NAKL 5ELIA 2P7TA 4CBZA 1Y18B 5E1AA 5AALA 1FYTD 4DCQB 1G9EA 1IBBA 2A0LD 1MFBH 2IC2A 5CNHA 5CXPA 3MCKA 5C0AA 3RWJB 3ULUH 4J1UB 1I7UB 2YRPA 5KS9F 2VDRL 3NAAH 4PG2A 1OP9A 3DV4A 3QUKB 3KYOA 1YPZE 4OIIL 2F8OA 3VYOA 3EBHA 3F7PC 3HG3A 4JKPL 4M5SA 2JELL 4GAYA 5F7WC 4GG6B 3JWDL 5C6PB 1ETZB 3O2DA 5T1MA 5DJCB 3RP1A 4LHQB 5J6GB 1PCXA 2OI9C 3DK0A 3QULB 4H25A 4P4KA 1E4JA 2GT9B 2QPFA 3OJDA 1QEXA 3L5WA 2AAVA 2ADGA 1JYNA 4K3JH 4RBPH 3VRLF 1I3UA 5AKTA 4R84A 4WUUD 4KQ0A 2C7FA 1HCYA 3FB8A 4JFHE 4BXSV 1NGQH 3W0WE 2BSED 1G7JA 3FJTA 3ULVE 1T3FB 1U92A 5CSBA 2XA8H 3W39A 2DLFH 4KQ4H 3FCBA 5ABZA 4NQCE 3VQ2C 2P45B 1J9CT 3BHBA 2X87A 3OL2A 4HUNB 3QXAB 1JPTL 1T66C 3IDNB 4KOCA 3WIHL 4F37F 4YZWA 4PS4L 4XPAL 2O30A 3CQFA 4MYPA 2BVPA 3LN4B 2ADGB 3SJVA 2C1PA 1UUNA 4HMEA 3TC9A 4DAGH 1MW3A 4PAZA 3KGUA 3FFCA 5L8JB 1GW6A 3U4BL 2FHCA 2OMBA 3CFMA 2QR0A 3W56A 4ZDHA 1JZ7A 2DQGH 1ZSDA 3H7LA 3CFDB 1GYVA 1MHCA 5DMGD 3D30A 4TMPA 3U2JA 2C1OA 3P0VH 1H9VA 3L9EA 4MNGE 4KJPD 1E4KA 4WW2F 5CZXD 5CD3B 1MFUA 2ICES 3VDBA 3H6JA 1B4LA 3P4MB 4D0DB 1RMFH 4H88L 5EZIH 2WXHA 3BT2L 3WN6A 2AQQA 3ULVH 5FF6B 3GMOB 4PJIF 4CGTA 4A63A 3DVGA 5LAXA 3O0LA 3VSTA 2V5MA 4YSOA 2RR3A 1VFOA 2VDOB 3EH1A 4M6MH 1U2HA 2BNRA 5F9AC 1CUOA 5EZOH 4LDCA 5C1MB 4P48A 5ANME 5GS0C 5LKNA 1S9VA 2OMYA 2JB6A 2WUBH 5MEOA 4HUWB 3S2AA 4N0CC 2P7TB 4WI3A 2H6UA 1AMYA 1R46A 4AOFA 2A0LC 1BYNA 5I17B 1WE5A 4FTVB 1J10A 3CVCA 4XN7A 3WS3A 5HI3D 4XWOD 2AC0A 1LE5B 4R96A 5KS9B 2B2XH 1XF4A 3O6MH 3T0EC 1HIMH 1FFOA 5HJ3A 3FOMB 5HD8D 1XSKA 1X5JA 4O58L 3VXQA 4HC1A 1TCRB 1SHXA 1XF2A 4C56D 4LF3B 1RJYA 1NMCC 2BC4B 3MBEB 7PAZA 2CLVB 4ZYKA 5KSBF 2QQLH 4AMKH 3KHQA 4AGNA 2WGXA 3HG0A 4I18C 3LIZH 4AXWB 5J1TC 1E4WH 4OIIH 4MMZB 3AXLA 4AQ8A 5L4MA 2XG5A 3QS3A 1WH0A 3LXAA 4NT6A 2UXGA 2IADB 4WDIB 3BVVA 4UMSA 4N0RA 3PUCA 4GKZA 5DVNA 4D9LH 3BSGA 4ZUUB 4XCNB 2UY7B 4CADB 4LB8A 2V2WA 5DMKA 4PLKC 3K1KC 2VN5A 5C0BE 4I1NB 4N8UA 1ZEAH 5LWYH 2QLVB 4JO8A 2VRAA 1UYWL 2J56A 2H41A 4P2OC 1RFDL 1DN0A 4LF3A 1EBAA 3DTUB 3PU7A 3A6OA 5IBLC 2VO8A 4GI6A 4K3JL 4L3AA 4MS8C 3D4GA 5F1OB 3MFFB 2B8OT 4FEMA 1JHLL 4NKDA 1U3JA 5L2KE 1ROCA 1SUJA 3VRJB 4KZEL 3OR6B 1CGYA 1NGQL 5IROD 4J4PC 3KWWA 2D73A 4WI8A 1Z2KA 4I0PB 4K9JA 3SE8L 5HSFA 4JFDE 4P99A 5G4MA 1PX4A 4FMVA 3RWCA 2CO1A 2CCWA 1E7VA 1JVKA 1JPTH 4G9DA 3RRQA 4FQLH 3WIHH 3WIFB 1LO4H 1XSJA 3VWJC 3C60D 1TVBA 1QZ1A 4L8BB 3NA9H 4GRMA 3V0IA 4YQXL 3WDHA 3CK0L 3O3EB 2CIIB 5JW4R 1D5IL 1CFSB 1F58H 3RZCB 2Q87A 2N01B 3O6LH 4O2CA 4DAGL 2E0PA 4N6RB 4M56A 4N22A 3C6LC 3RNQB 4Z3GA 1K4CB 3WJJC 5A2KH 4QO1A 1IKOP 4OLWL 2FH6A 2IALA 2EIDA 4MAYA 3VFSB 4M03A 5F3HB 3RB5A 3RUGE 2MPAH 2XPZA 5EO0A 4ES8A 4IOFD 1YN6A 3LEXB 3MRDA 2H7WA 4UM8A 2F6AA 2XKUA 4WSJA 1P4LB 4XE5B 2WO4A 3DURB 1UCBH 4Z7IA 3AY4A 4H88H 5KVFH 5FYKE 4F8NA 2JK5B 3SY0A 3ULVL 3EJTA 3HUJE 1IC1A 4Y16A 2Y3NA 1U3YA 4LLDA 2QJDA 3QIWA 3RE0A 4JRWA 1BQKA 1JWMA 2X4SA 2WBJC 3LKQB 3IAPA 4UT9L 2X70B 2CBTA 4A7UA 4AUYA 3QNXA 1WF5A 5K1VA 1AE6L 2ZXBA 1IAIM 2AXGB 3P9WB 2WXPA 2VE6A 4X5QA 4WK2B 5ICZA 2WUBL 4EQ2A 2XETA 4GRWB 4HEME 4TSAL 4Z7VA 1AR1B 1R1CA 2X4PB 4YGAB 2DRUA 1LHZA 5JMOC 3PV6A 1KJMB 4K5LA 3ZRSA 4GG8A 3RVWD 2FLMA 1N4XL 4PJAF 1GGTA 4X8JA 3BXNA 3VFTA 3RQ3A 1I9JL 4P4KC 3JVFC 1DSFH 4HJTA 4N0FA 5B1JA 5FYKD 3O6ML 2B4CH 3CNKA 1NGWA 1H0DB 1KPVB 1V10A 1YMHB 4GLRI 1ZA3A 3FNKA 5C0EA 1R33A 3FTUA 4JLRA 2Z31A 4N2DA 4AUUA 4BH7A 4DO6A 1GJIA 2ZJSL 2VDOH 4O58H 2AANA 4XPBH 1HINL 3MV8E 4CVWA 3BCDA 3KM1A 3UTTA 2FEJA 3T04D 1HL9A 3BAEH 1LDPL 2A9CA 3E2HB 4J3SA 2NPLX 2VLKE 3WUZA 2X12A 2R7EB 3V6FA 4PG2C 2QKIC 1QPKA 5GRXG 2VC2L 3F7QA 1Z66A 2BCMA 1TDQA 2XT1B 4FLHA 4KZCA 3B4NA 3QXWA 1IBDA 2XI9A 1P0SE 3MREB 3IMRA 1PVHA 4L1LA 1CLVA 4OGXH 3CSTA 4KVNL 4EMZA 4A6YA 1TZHB 2XA3A 4H4NA 3J27A 2GJJA 4HFWB 3D3VE 3WDJA 4I0PA 1NGXA 2BP0B 1AHWA 3DECA 5FCSH 1NGPH 2JLLA 4EZKA 3PWPD 4LSQL 4JFOA 2TRHA 4I89A 2H6OA 4M61A 4Y5YB 3GKWH 4NJ9H 4B9GA 3AITA 1GCFA 4RLDA 2NSMA 4M5TA 3TV8A 4E42A 2H0JA 3OXSB 4F7TA 1IM9B 3KWXA 4LEEA 4AZ8B 4OIBA 1JHLH 1LQSR 3SHSA 3PXHA 4QRRA 3IGAB 2UXVA 3WEOA 5I66A 1CTNA 1TR7A 4P2OA 5F0LB 4ELMB 4CSPA 4GQQA 3MRFA 3EOYG 2AQNA 5C0BD 5GGRY 3ZO9A 3IFPB 3HE7A 5I1AA 4YDMA 2YBRB 2H32B 3PWVA 4FQLL 4CNIB 3MRRA 2OAAA 2BNQA 5BUAA 5DTFA 3CN4A 3Q2WA 4B0MM 3NVQA 1OQXA 2UY6A 3VI3E 1KN4H 4FTVE 1JI1A 4XBEH 1QA9B 2NR6A 1F58L 3O6LL 1A7QL 2Y23A 3P0YH 3N85H 2BY2A 2TSAA 3SSGA 4CDHA 1GS8A 1WK0A 3CHSA 3VW3H 4ODVH 1U30A 4OLWH 1ORQA 3AVEA 4HS3B 3MXVL 1OTSD 5IFAL 4MCZA 1KGIA 3X3GH 2MPAL 3NFPA 3ZN6A 5EN3A 1A7PL 4UQ3A 4UQ3B 2X0VA 1Q1PA 1WHOA 1IT9L 1M7UA 2Q2EB 1JOIA 1WBZA 3FT3B 4JFEA 1BGXL 4U05A 4HU2A 4DGVH 1UCBL 2ZXGA 3CFNA 2VMCA 5KVFL 2BNRD 4AYBA 3LKNA 3L3JA 3IDYB 5EF2A 1Z9MA 2DDQH 2P80A 3T6ZA 3QK0A 4BZ1A 2CRMA 2PXYA 3UBXI 1PIFA 1E5UI 2BS71 5F7NC 1R19A 1E27B 2OR7A 2YIHA 2EDOA 3BAWA 1MHEA 5TDOA 4WF7A 2M2DA 2K9FB 2X4UB 4LSPH 3LQAC 3G9AB 4NQDA 2DYRB 2CRYA 5FKPB 1ZXKA 2XQYG 4ZX4A 3EOAA 4UB0H 4OF6A 1CMOA 2WWMC 2MCMA 1H8SA 3ZMNA 3MNZB 1LMIA 2AK1L 2FZ3A 1COBA 1UA3A 4TVPD 5ADPH 4BUGA 1BMGA 5IW1B 4EPSA 2L7EA 5BVPL 1NGYA 3I9GL 3X1EA 1DSFL 1FNAA 2F0CA 4Q6IB 1N6UA 4OZFH 3ZQWA 2B4CL 5CGBA 4IRSC 1CDHA 4M7LT 2WCPA 2VZVA 4NJAH 3CFTA 1F5WA 1N70A 1IBFA 1BAWA 1MCCA 2ZJSH 1F4HA 4QKTA 3S5LG 5F89B 1A65A 2DLGA 2HCZX 2YPVH 4GLRH 4DZBA 2ERJC 2JJSA 1PQZA 3BAEL 4GXFA 4XMVA 3U36A 5EORL 4X2UA 4LL1A 3WAJA 2ZOUA 2NQ3A 2V2WB 3NCYP 4PY8J 4ZZKA 1RU9L 1USQA 2C34A 1PJ9A 1WC7B 3IGUA 3SE9L 2CGRH 3R7RA 2YPKA 3KXFA 3TASA 3AT8A 3ZE0E 4B9JA 1YEKH 1QG3A 5ACMA 1P7HL 3UTZA 3LPFA 2Y2TA 5DSCA 4AYFB 4CN6A 4U6VL 1DQLH 2X88A 4OGXL 2PXYD 4IQHA 4ZODA 4C54A 2C3VB 3GLZA 3SOTA 4RRPM 1NUFA 3N1GC 5HDBB 3IRPX 3QAZB 4G8EB 1OZTG 4TLSA 4ATWA 3FSAA 1HKLH 3NK4A 5BZDA 3T0EE 3LQZA 5TFSL 1MW1A 3MA7A 2DQCH 1PJWA 1AC0A 4XT1C 5E1IA 2BINA 4IW4C 1J0HA 5J12B 5FWRA 4AYMC 1H3UA 3GBMH 5ENWB 4HZAA 2Z4QA 2GC7C 3GSWA 3N44B 4EN3B 3WGVB 3BZFA 4ZTOH 2CUMA 1UXSA 3BUYB 4F7PA 43C9A 4FZEH 2FEDC 2AQRA 1VCBC 1EEZA 1H6TA 5T1DL 4BHUA 2YK1L 4UANA 1KLUB 5C07B 3M7OA 4BFRA 2P5ED 2L7UA 1C16B 4RMRA 2ADFH 3TBSA 2D3LA 2CJ3A 4FQ1L 2BCKB 2EDMA 2GUOB 2W92A 4JN2B 3MA7B 3W1ZA 1CQKA 1P2CA 1TJXA 1UWEH 2R0WL 1OANA 5FOBA 1A7QH 3A23A 1U93A 1GW0A 3KLAB 1HAUA 3P0YL 4WSGA 1AHMA 3ILPB 3QYNA 4XTRC 1BDYA 4HGWB 4XMZA 2ZF9A 4KXCA 4QXGH 3TJHC 1MJ8L 1JZEA 1GVIA 3X3GL 1A7PH 4GIAA 4GRLD 4AQZA 4NKOA 3HNTH 4R7NA 3LNGA 2F7PA 3UTTE 1XGPA 4DGVL 5I1GL 1JWUB 1KULA 4J8RB 1Z9LA 3D52A 3MVSA 4HCFA 4HJ0C 5KVDL 1B0GA 3EJJX 3KPLB 1GKOA 4JRLA 4YIQB 4W93A 2YD1A 4PJHB 4ALAH 3RDJA 2AJSH 3PPEA 5AL8A 4JN2A 2YN3A 4LCCC 4EEEA 1N59B 2XPYA 4JQIL 4D9RE 1JGVH 4LASL 2ROYA 4FCAA 4TSBL 1OZUA 1MCOL 3RPIA 1XF3B 3AXIA 2Y7SA 2GCYA 4HLZH 2HFFA 2F54B 4P23A 3ROOA 3VB8A 1TZ8A 4LRIA 4ABQA 4E9QA 2JTDA 3MLYH 3WNPA 2K7PA 3B7SA 3R8QA 1G6VK 4F15B 1OAYL 1MFEL 4KKAC 2D03H 3ULVC 3V55A 1CFMA 4TV3A 3CDZB 4FQ2H 5ADPL 1ULVA 3DO3A 4LXFA 3ELAT 2J8UE 3QWOB 4QNPF 2HKHH 1TTBA 4U1IA 2CDFA 2ESVE 2D4DA 2HRHA 2HG5B 5DRNB 4F20A 4NZRL 4OW6A 2IBGA 5KYNA 1R5WB 2VXSL 2EC8A 5C9JB 1PEZA 1MH5A 2PO6C 3BYTA 1V7ML 3ECVA 4IIQA 2GBVA 1N6VA 3CZFB 2VWEE 2NMSA 5KSAA 1FH5H 1JZHA 2WXRA 3FB7A 1JTOA 4KK9D 3RTQB 2B16A 4OCRH 3GIVB 1FF5A 2VDMB 3JWNH 4RIRB 4YPGA 3WFCL 2VZUA 3MRQB 4ZFFB 5BO0D 4NUPA 3ABKB 3KPSA 4Z7UB 1QSFA 2WXIA 1INEL 2YWZA 5I26A 4K8RD 1YEKL 5GJTL 1NKOA 4I7ZC 5BW7C 4H20H 1DQLL 1CD1A 3P9LB 3KWTA 3WLBB 1I31A 5F7AA 3BIKB 3BIKA 5F0JB 1JGEA 2A4CA 1OEZW 4I2XB 4LCCA 3FFCB 2HVJA 5B22A 5IQLA 1RUKL 2DWDB 4XMUA 5IVZB 3KBEA 4QR7A 1G5GA 5IB2B 2DQCL 5C0FA 3LNDA 1U8IA 3PAYA 5JPMC 1BAGA 1UM5L 1XF5B 1IAII 5C0JA 3D39A 3GBML 1UWXK 4ZFFA 4NFBA 3H55A 1DJYA 5I1JH 1OW0A 4XP6L 3FK3A 3BH8B 3CHPA 2NDFA 5FYKU 1SRDA 3MV7D 1VFAB 3QCUH 4J3TA 1BXUA 5DVMA 4KHXL 5FC9A 1NCWL 1VAHA 3MRJB 1SZNA 4HK0A 1A4JA 3VI4B 3DI2B 2GI7A 1G9HA 1NC4B 5SV4A 3ZJAA 4C4UA 2RBLA 1B0WA 3FCSA 1BFVH 1MUJB 3LRSB 5KTEH 5AVXB 3D9AH 4TNVF 3NZHL 2FX8L 2A4ZA 2AHIA 1TQBB 4FQ1H 4GKOA 1C1EH 2EZ0C 3MRHA 4WK4B 1QUNA 2R0WH 1UWEL 3L1EA 1QPXA 1MHCB 1R34A 2ZP9A 1TZIB 2E76C 4MA7H 4OLUH 1ZLSL 4UM9B 4Y5XA 2FO4B 4N8CH 3N0AA