6PRCL

Photosynthetic reaction center from rhodopseudomonas viridis (dg-420314 (triazine) complex)
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
273
structure length
273
Chain Sequence
ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPLLEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNFGYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNIFLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
pubmed doi rcsb
molecule keywords PHOTOSYNTHETIC REACTION CENTER
molecule tags Photosynthetic reaction center
total genus 104
structure length 273
sequence length 273
ec nomenclature
pdb deposition date 1997-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00124 Photo_RC Photosynthetic reaction centre protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 6prcL01
1.20.85.10 Mainly Alpha Up-down Bundle Photosynthetic Reaction Center, subunit M; domain 1 Photosystem II protein D1-like 6prcL02
2I5NM 2I5NL 6PRCL 1FNQM 7PRCL 3ZUWL 1DXRM 1DXRL 2JBLM 2JBLL 3DU3L 1QOVM 1QOVL 1M3XM 1F6NL 1S00M 1JGZL 1S00L 1RVJL 2HHKM 2HITM 2HITL 1DS8M 1DS8L 1PSSL 2BNPA 3DUQM 3ZUMM 1AIGL 1DV3L 4N7LM 4HBJM 2JJ0M 2JJ0L 1UMXM 1DV6M 1UMXL 2HG3L 2HG3M 2UXMM 2WJMM 2UXJM 2UXJL 3DU2M 3DU2L 1MPSM 4TQQL 2UXKM 2UXKL 2J8CM 1AIJM 2HH1L 2UWVM 2UWVL 5PRCM 5PRCL 1RZHM 1RQKM 2GMRL 2GMRM 2X5VM 1YF6M 1YF6L 2UX5M 4H9LM 2BNSB 1E6DM 1FNQL 1FNPM 1K6LM 1K6LL 2PRCM 1PCRM 1PCRL 5LSEM 5LSEL 1M3XL 1K6NM 2UWTM 2HHKL 2RCRM 3DSYM 3DUQL 2BNSA 3V3YM 4RCRM 4RCRL 3ZUML 1L9BM 4N7LL 4HBJL 1DV6L 1PRCM 1PRCL 1VRNM 2UXML 2WJML 1RZZM 2HJ6M 2HJ6L 3T6DM 1MPSL 2J8DL 2J8DM 3WMMM 2UXLM 2J8CL 2UXLL 1AIJL 1PSTM 4IN7M 2UX3M 2UX3L 1RQKL 1RZHL 4LWYM 2X5VL 4LWYL 1RY5M 2JIYM 2JIYL 2UX5L 1L9JM 4H9LL 3PRCM 1E6DL 1FNPL 3D38M 3D38L 2PRCL 1JGXM 1JGXL 2HG9M 1K6NL 2UWTL 1RG5M 1RG5L 2WJNM 3DTSM 3DTSL 2RCRL 3DSYL 1JGYM 3DTRM 1RGNM 3DTAM 3DTAL 4IN5M 4IN5L 1L9BL 3V3YL 1JGWM 1JGWL 3V3ZM 3T6EM 3T6EL 1OGVM 5LRIM 1R2CM 1VRNL 1RZZL 1E14M 4IN6M 2UWSM 2UWSL 3T6DL 2UX4M 2UWUM 4CASB 4N7KM 3WMML 2BNPB 7PRCM 1PSTL 3ZUWM 2GNUM 2GNUL 1JH0M 1JH0L 4IN7L 3DU3M 3I4DM 3I4DL 1RY5L 1F6NM 1L9JL 3PRCL 1JGZM 1RVJM 1YSTM 1YSTL 1PSSM 2X5UM 2HG9L 2X5UL 1AIGM 1DV3M 2UWWM 2UWWL 2WJNL 1JGYL 1KBYM 1KBYL 3DTRL 1RGNL 4H99L 4H99M 1EYSM 1EYSL 3G7FL 3G7FM 4TQQM 3V3ZL 2BOZM 2BOZL 4CASC 1OGVL 2HH1M 5LRIL 1R2CL 1E14L 4IN6L 4HBHM 4HBHL 2UX4L 2UWUL 6PRCM 4N7KL 2WX5M 2WX5L
chains in the Genus database with same CATH superfamily
2I5NM 2I5NL 6PRCL 1FNQM 7PRCL 3ZUWL 1DXRM 1DXRL 2JBLM 2JBLL 3DU3L 1QOVM 1QOVL 1M3XM 1F6NL 1S00M 1JGZL 1S00L 1RVJL 3WRYC 2HHKM 2HITM 2HITL 1DS8M 1DS8L 1PSSL 2BNPA 3DUQM 3ZUMM 1AIGL 1DV3L 4N7LM 4HBJM 2JJ0M 2JJ0L 1UMXM 1DV6M 1UMXL 2HG3L 2HG3M 2UXMM 2WJMM 2UXJM 2UXJL 3DU2M 3DU2L 1MPSM 4TQQL 2UXKM 2UXKL 2J8CM 1AIJM 2HH1L 2UWVM 2UWVL 5PRCM 5PRCL 1RZHM 1RQKM 2GMRL 2GMRM 2X5VM 1YF6M 1YF6L 2UX5M 4H9LM 2BNSB 1E6DM 1FNQL 1FNPM 1K6LM 1K6LL 2PRCM 1PCRM 1PCRL 5LSEM 5LSEL 1M3XL 1K6NM 2UWTM 2HHKL 2RCRM 3DSYM 3DUQL 2BNSA 3V3YM 4RCRM 4RCRL 3ZUML 1L9BM 4N7LL 4HBJL 1DV6L 1PRCM 1PRCL 1VRNM 2UXML 2WJML 1RZZM 2HJ6M 2HJ6L 3T6DM 1MPSL 2J8DL 2J8DM 3WRXC 3WMMM 2UXLM 2J8CL 2UXLL 1AIJL 1PSTM 4IN7M 3VKWA 2UX3M 2UX3L 1RQKL 1RZHL 4LWYM 2X5VL 4LWYL 1RY5M 2JIYM 2JIYL 2UX5L 1L9JM 4H9LL 3PRCM 1E6DL 1FNPL 3D38M 3D38L 2PRCL 1JGXM 1JGXL 2HG9M 1K6NL 2UWTL 1RG5M 1RG5L 2WJNM 3DTSM 3DTSL 2RCRL 3DSYL 1JGYM 3DTRM 1RGNM 3DTAM 3DTAL 4IN5M 4IN5L 1L9BL 3V3YL 1JGWM 1JGWL 3V3ZM 3T6EM 3T6EL 1OGVM 5LRIM 1R2CM 1VRNL 1RZZL 1E14M 4IN6M 2UWSM 2UWSL 3T6DL 2UX4M 2UWUM 4CASB 4N7KM 3WMML 2BNPB 7PRCM 1PSTL 3ZUWM 2GNUM 2GNUL 1JH0M 1JH0L 4IN7L 3DU3M 3I4DM 3I4DL 1RY5L 1F6NM 1L9JL 3PRCL 1JGZM 1RVJM 1YSTM 1YSTL 1PSSM 2X5UM 2HG9L 2X5UL 1AIGM 1DV3M 2UWWM 2UWWL 2WJNL 1JGYL 1KBYM 1KBYL 3DTRL 1RGNL 4H99L 4H99M 1EYSM 1EYSL 3G7FL 3G7FM 4TQQM 3V3ZL 2BOZM 2BOZL 4CASC 1OGVL 2HH1M 5LRIL 1R2CL 1E14L 4IN6L 4HBHM 4HBHL 2UX4L 2UWUL 6PRCM 4N7KL 2WX5M 2WX5L
chains in the Genus database with same CATH topology
2I5NM 2I5NL 6PRCL 1FNQM 7PRCL 3ZUWL 1DXRM 1DXRL 2JBLM 2JBLL 3DU3L 1QOVM 1QOVL 1M3XM 1F6NL 1S00M 1JGZL 1S00L 1RVJL 2HHKM 2HITM 2HITL 1DS8M 1DS8L 1PSSL 2BNPA 3DUQM 3ZUMM 1AIGL 1DV3L 4N7LM 4HBJM 2JJ0M 2JJ0L 1UMXM 1DV6M 1UMXL 2HG3L 2HG3M 2UXMM 2WJMM 2UXJM 2UXJL 3DU2M 3DU2L 1MPSM 4TQQL 2UXKM 2UXKL 2J8CM 1AIJM 2HH1L 2UWVM 2UWVL 5PRCM 5PRCL 1RZHM 1RQKM 2GMRL 2GMRM 2X5VM 1YF6M 1YF6L 2UX5M 4H9LM 2BNSB 1E6DM 1FNQL 1FNPM 1K6LM 1K6LL 2PRCM 1PCRM 1PCRL 5LSEM 5LSEL 1M3XL 1K6NM 2UWTM 2HHKL 2RCRM 3DSYM 3DUQL 2BNSA 3V3YM 4RCRM 4RCRL 3ZUML 1L9BM 4N7LL 4HBJL 1DV6L 1PRCM 1PRCL 1VRNM 2UXML 2WJML 1RZZM 2HJ6M 2HJ6L 3T6DM 1MPSL 2J8DL 2J8DM 3WMMM 2UXLM 2J8CL 2UXLL 1AIJL 1PSTM 4IN7M 2UX3M 2UX3L 1RQKL 1RZHL 4LWYM 2X5VL 4LWYL 1RY5M 2JIYM 2JIYL 2UX5L 1L9JM 4H9LL 3PRCM 1E6DL 1FNPL 3D38M 3D38L 2PRCL 1JGXM 1JGXL 2HG9M 1K6NL 2UWTL 1RG5M 1RG5L 2WJNM 3DTSM 3DTSL 2RCRL 3DSYL 1JGYM 3DTRM 1RGNM 3DTAM 3DTAL 4IN5M 4IN5L 1L9BL 3V3YL 1JGWM 1JGWL 3V3ZM 3T6EM 3T6EL 1OGVM 5LRIM 1R2CM 1VRNL 1RZZL 1E14M 4IN6M 2UWSM 2UWSL 3T6DL 2UX4M 2UWUM 4CASB 4N7KM 3WMML 2BNPB 7PRCM 1PSTL 3ZUWM 2GNUM 2GNUL 1JH0M 1JH0L 4IN7L 3DU3M 3I4DM 3I4DL 1RY5L 1F6NM 1L9JL 3PRCL 1JGZM 1RVJM 1YSTM 1YSTL 1PSSM 2X5UM 2HG9L 2X5UL 1AIGM 1DV3M 2UWWM 2UWWL 2WJNL 1JGYL 1KBYM 1KBYL 3DTRL 1RGNL 4H99L 4H99M 1EYSM 1EYSL 3G7FL 3G7FM 4TQQM 3V3ZL 2BOZM 2BOZL 4CASC 1OGVL 2HH1M 5LRIL 1R2CL 1E14L 4IN6L 4HBHM 4HBHL 2UX4L 2UWUL 6PRCM 4N7KL 2WX5M 2WX5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I5N M;  2I5N L;  6PRC L;  1FNQ M;  7PRC L;  3ZUW L;  1DXR M;  1DXR L;  2JBL M;  2JBL L;  3DU3 L;  1QOV M;  1QOV L;  1M3X M;  1F6N L;  1S00 M;  1JGZ L;  1S00 L;  1RVJ L;  2HHK M;  2HIT M;  2HIT L;  1DS8 M;  1DS8 L;  1PSS L;  2BNP A;  3DUQ M;  3ZUM M;  1AIG L;  1DV3 L;  4N7L M;  4HBJ M;  2JJ0 M;  2JJ0 L;  1UMX M;  1DV6 M;  1UMX L;  2HG3 L;  2HG3 M;  2UXM M;  2WJM M;  2UXJ M;  2UXJ L;  3DU2 M;  3DU2 L;  1MPS M;  4TQQ L;  2UXK M;  2UXK L;  2J8C M;  1AIJ M;  2HH1 L;  2UWV M;  2UWV L;  5PRC M;  5PRC L;  1RZH M;  1RQK M;  2GMR L;  2GMR M;  2X5V M;  1YF6 M;  1YF6 L;  2UX5 M;  4H9L M;  2BNS B;  1E6D M;  1FNQ L;  1FNP M;  1K6L M;  1K6L L;  2PRC M;  1PCR M;  1PCR L;  5LSE M;  5LSE L;  1M3X L;  1K6N M;  2UWT M;  2HHK L;  2RCR M;  3DSY M;  3DUQ L;  2BNS A;  3V3Y M;  4RCR M;  4RCR L;  3ZUM L;  1L9B M;  4N7L L;  4HBJ L;  1DV6 L;  1PRC M;  1PRC L;  1VRN M;  2UXM L;  2WJM L;  1RZZ M;  2HJ6 M;  2HJ6 L;  3T6D M;  1MPS L;  2J8D L;  2J8D M;  3WMM M;  2UXL M;  2J8C L;  2UXL L;  1AIJ L;  1PST M;  4IN7 M;  2UX3 M;  2UX3 L;  1RQK L;  1RZH L;  4LWY M;  2X5V L;  4LWY L;  1RY5 M;  2JIY M;  2JIY L;  2UX5 L;  1L9J M;  4H9L L;  3PRC M;  1E6D L;  1FNP L;  3D38 M;  3D38 L;  2PRC L;  1JGX M;  1JGX L;  2HG9 M;  1K6N L;  2UWT L;  1RG5 M;  1RG5 L;  2WJN M;  3DTS M;  3DTS L;  2RCR L;  3DSY L;  1JGY M;  3DTR M;  1RGN M;  3DTA M;  3DTA L;  4IN5 M;  4IN5 L;  1L9B L;  3V3Y L;  1JGW M;  1JGW L;  3V3Z M;  3T6E M;  3T6E L;  1OGV M;  5LRI M;  1R2C M;  1VRN L;  1RZZ L;  1E14 M;  4IN6 M;  2UWS M;  2UWS L;  3T6D L;  2UX4 M;  2UWU M;  4CAS B;  4N7K M;  3WMM L;  2BNP B;  7PRC M;  1PST L;  3ZUW M;  2GNU M;  2GNU L;  1JH0 M;  1JH0 L;  4IN7 L;  3DU3 M;  3I4D M;  3I4D L;  1RY5 L;  1F6N M;  1L9J L;  3PRC L;  1JGZ M;  1RVJ M;  1YST M;  1YST L;  1PSS M;  2X5U M;  2HG9 L;  2X5U L;  1AIG M;  1DV3 M;  2UWW M;  2UWW L;  2WJN L;  1JGY L;  1KBY M;  1KBY L;  3DTR L;  1RGN L;  4H99 L;  4H99 M;  1EYS M;  1EYS L;  3G7F L;  3G7F M;  4TQQ M;  3V3Z L;  2BOZ M;  2BOZ L;  4CAS C;  1OGV L;  2HH1 M;  5LRI L;  1R2C L;  1E14 L;  4IN6 L;  4HBH M;  4HBH L;  2UX4 L;  2UWU L;  6PRC M;  4N7K L;  2WX5 M;  2WX5 L; 
#chains in the Genus database with same CATH topology
 2I5N M;  2I5N L;  6PRC L;  1FNQ M;  7PRC L;  3ZUW L;  1DXR M;  1DXR L;  2JBL M;  2JBL L;  3DU3 L;  1QOV M;  1QOV L;  1M3X M;  1F6N L;  1S00 M;  1JGZ L;  1S00 L;  1RVJ L;  3WRY C;  2HHK M;  2HIT M;  2HIT L;  1DS8 M;  1DS8 L;  1PSS L;  2BNP A;  3DUQ M;  3ZUM M;  1AIG L;  1DV3 L;  4N7L M;  4HBJ M;  2JJ0 M;  2JJ0 L;  1UMX M;  1DV6 M;  1UMX L;  2HG3 L;  2HG3 M;  2UXM M;  2WJM M;  2UXJ M;  2UXJ L;  3DU2 M;  3DU2 L;  1MPS M;  4TQQ L;  2UXK M;  2UXK L;  2J8C M;  1AIJ M;  2HH1 L;  2UWV M;  2UWV L;  5PRC M;  5PRC L;  1RZH M;  1RQK M;  2GMR L;  2GMR M;  2X5V M;  1YF6 M;  1YF6 L;  2UX5 M;  4H9L M;  2BNS B;  1E6D M;  1FNQ L;  1FNP M;  1K6L M;  1K6L L;  2PRC M;  1PCR M;  1PCR L;  5LSE M;  5LSE L;  1M3X L;  1K6N M;  2UWT M;  2HHK L;  2RCR M;  3DSY M;  3DUQ L;  2BNS A;  3V3Y M;  4RCR M;  4RCR L;  3ZUM L;  1L9B M;  4N7L L;  4HBJ L;  1DV6 L;  1PRC M;  1PRC L;  1VRN M;  2UXM L;  2WJM L;  1RZZ M;  2HJ6 M;  2HJ6 L;  3T6D M;  1MPS L;  2J8D L;  2J8D M;  3WRX C;  3WMM M;  2UXL M;  2J8C L;  2UXL L;  1AIJ L;  1PST M;  4IN7 M;  3VKW A;  2UX3 M;  2UX3 L;  1RQK L;  1RZH L;  4LWY M;  2X5V L;  4LWY L;  1RY5 M;  2JIY M;  2JIY L;  2UX5 L;  1L9J M;  4H9L L;  3PRC M;  1E6D L;  1FNP L;  3D38 M;  3D38 L;  2PRC L;  1JGX M;  1JGX L;  2HG9 M;  1K6N L;  2UWT L;  1RG5 M;  1RG5 L;  2WJN M;  3DTS M;  3DTS L;  2RCR L;  3DSY L;  1JGY M;  3DTR M;  1RGN M;  3DTA M;  3DTA L;  4IN5 M;  4IN5 L;  1L9B L;  3V3Y L;  1JGW M;  1JGW L;  3V3Z M;  3T6E M;  3T6E L;  1OGV M;  5LRI M;  1R2C M;  1VRN L;  1RZZ L;  1E14 M;  4IN6 M;  2UWS M;  2UWS L;  3T6D L;  2UX4 M;  2UWU M;  4CAS B;  4N7K M;  3WMM L;  2BNP B;  7PRC M;  1PST L;  3ZUW M;  2GNU M;  2GNU L;  1JH0 M;  1JH0 L;  4IN7 L;  3DU3 M;  3I4D M;  3I4D L;  1RY5 L;  1F6N M;  1L9J L;  3PRC L;  1JGZ M;  1RVJ M;  1YST M;  1YST L;  1PSS M;  2X5U M;  2HG9 L;  2X5U L;  1AIG M;  1DV3 M;  2UWW M;  2UWW L;  2WJN L;  1JGY L;  1KBY M;  1KBY L;  3DTR L;  1RGN L;  4H99 L;  4H99 M;  1EYS M;  1EYS L;  3G7F L;  3G7F M;  4TQQ M;  3V3Z L;  2BOZ M;  2BOZ L;  4CAS C;  1OGV L;  2HH1 M;  5LRI L;  1R2C L;  1E14 L;  4IN6 L;  4HBH M;  4HBH L;  2UX4 L;  2UWU L;  6PRC M;  4N7K L;  2WX5 M;  2WX5 L; 
#chains in the Genus database with same CATH homology
 2I5N M;  2I5N L;  6PRC L;  1FNQ M;  7PRC L;  3ZUW L;  1DXR M;  1DXR L;  2JBL M;  2JBL L;  3DU3 L;  1QOV M;  1QOV L;  1M3X M;  1F6N L;  1S00 M;  1JGZ L;  1S00 L;  1RVJ L;  2HHK M;  2HIT M;  2HIT L;  1DS8 M;  1DS8 L;  1PSS L;  2BNP A;  3DUQ M;  3ZUM M;  1AIG L;  1DV3 L;  4N7L M;  4HBJ M;  2JJ0 M;  2JJ0 L;  1UMX M;  1DV6 M;  1UMX L;  2HG3 L;  2HG3 M;  2UXM M;  2WJM M;  2UXJ M;  2UXJ L;  3DU2 M;  3DU2 L;  1MPS M;  4TQQ L;  2UXK M;  2UXK L;  2J8C M;  1AIJ M;  2HH1 L;  2UWV M;  2UWV L;  5PRC M;  5PRC L;  1RZH M;  1RQK M;  2GMR L;  2GMR M;  2X5V M;  1YF6 M;  1YF6 L;  2UX5 M;  4H9L M;  2BNS B;  1E6D M;  1FNQ L;  1FNP M;  1K6L M;  1K6L L;  2PRC M;  1PCR M;  1PCR L;  5LSE M;  5LSE L;  1M3X L;  1K6N M;  2UWT M;  2HHK L;  2RCR M;  3DSY M;  3DUQ L;  2BNS A;  3V3Y M;  4RCR M;  4RCR L;  3ZUM L;  1L9B M;  4N7L L;  4HBJ L;  1DV6 L;  1PRC M;  1PRC L;  1VRN M;  2UXM L;  2WJM L;  1RZZ M;  2HJ6 M;  2HJ6 L;  3T6D M;  1MPS L;  2J8D L;  2J8D M;  3WMM M;  2UXL M;  2J8C L;  2UXL L;  1AIJ L;  1PST M;  4IN7 M;  2UX3 M;  2UX3 L;  1RQK L;  1RZH L;  4LWY M;  2X5V L;  4LWY L;  1RY5 M;  2JIY M;  2JIY L;  2UX5 L;  1L9J M;  4H9L L;  3PRC M;  1E6D L;  1FNP L;  3D38 M;  3D38 L;  2PRC L;  1JGX M;  1JGX L;  2HG9 M;  1K6N L;  2UWT L;  1RG5 M;  1RG5 L;  2WJN M;  3DTS M;  3DTS L;  2RCR L;  3DSY L;  1JGY M;  3DTR M;  1RGN M;  3DTA M;  3DTA L;  4IN5 M;  4IN5 L;  1L9B L;  3V3Y L;  1JGW M;  1JGW L;  3V3Z M;  3T6E M;  3T6E L;  1OGV M;  5LRI M;  1R2C M;  1VRN L;  1RZZ L;  1E14 M;  4IN6 M;  2UWS M;  2UWS L;  3T6D L;  2UX4 M;  2UWU M;  4CAS B;  4N7K M;  3WMM L;  2BNP B;  7PRC M;  1PST L;  3ZUW M;  2GNU M;  2GNU L;  1JH0 M;  1JH0 L;  4IN7 L;  3DU3 M;  3I4D M;  3I4D L;  1RY5 L;  1F6N M;  1L9J L;  3PRC L;  1JGZ M;  1RVJ M;  1YST M;  1YST L;  1PSS M;  2X5U M;  2HG9 L;  2X5U L;  1AIG M;  1DV3 M;  2UWW M;  2UWW L;  2WJN L;  1JGY L;  1KBY M;  1KBY L;  3DTR L;  1RGN L;  4H99 L;  4H99 M;  1EYS M;  1EYS L;  3G7F L;  3G7F M;  4TQQ M;  3V3Z L;  2BOZ M;  2BOZ L;  4CAS C;  1OGV L;  2HH1 M;  5LRI L;  1R2C L;  1E14 L;  4IN6 L;  4HBH M;  4HBH L;  2UX4 L;  2UWU L;  6PRC M;  4N7K L;  2WX5 M;  2WX5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...