6PRNA

E1m, k50a, r52a mutant of rh. blastica porin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAALAMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PORIN
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 6prnA00
3T0SA 4LSHA 1HXTA 3PRNA 3SYSA 1GFQA 3T20A 2PRNA 3K19A 4RJWA 1PRNA 4AUIA 3SYBA 5JDPA 2ZFGA 4D64A 1MPFA 2Y0KA 3VZTX 3POQA 3NSGA 2Y0HA 4FOZA 4FT6A 2OMFA 2J1NA 5DL5A 4LSIA 3T24A 1OSMA 3HW9A 4D5UA 4KR8A 4LSFA 4KRAA 5DL6A 4D65A 1H6S1 1HXUA 2PORA 1BH3A 1GFPA 7PRNA 2K4TA 3POXA 3UU2A 1BT9A 1OPFA 3PORA 2XE1A 3SZDA 2XG6A 1GFNA 1PHOA 5DL8A 3SY9A 2QTKA 3UPGA 3WI4A 3POUA 2J4UP 3VZUX 4FRTA 4BUMX 1GFMA 4FMSA 1GFOA 2FGRA 3VY9X 1E54A 3SY7A 5PRNA 3VY8X 2Y2XA 4C69X 4GCQA 4LSEA 4RJXA 3VZWX 3SZVA 3HWBA 2ODJA 5DL7A 4FRXA 2Y0LA 1HXXA 8PRNA 6PRNA 3FYXA 3EMNX 3WI5A 2XE5A 2ZLDA 3A2SX 2XE3A 4FSOA 3JTYA 4FSPA 5FVNA 4JFBA 3O0EA 4KR4A 2FGQX 2O4VA 4GCSA 4GCPA 2XE2A
chains in the Genus database with same CATH superfamily
2KC0A 3T0SA 2IWVA 4B61A 4LSHA 1HXTA 3PQUA 2KZ7A 1ZHYA 5B66O 3PRNA 3AA7A 3SYSA 1GFQA 2KXPB 3PGSA 3T20A 4C4VB 5G39A 2PRNA 1QJ8A 3DZMA 4Z3TA 4AYMC 1QJPA 1ZHTA 5ADXK 3K19A 4RJWA 3PGUA 4N74A 1PRNA 4AUIA 3NJTA 1P4TA 3AAAB 4RL9A 3SYBA 2ZFGA 3KVDD 3AAEA 4N59A 4AYNA 4AZLA 2JMMA 3LK42 4D64A 5TISO 2WJRA 3PF1A 2AXTO 1IZNB 1MPFA 2X9KA 2Y0KA 3VZTX 3A0HO 4AYID 3POQA 4FZNA 4O3ZA 3LK3B 3NSGA 4FZMA 4FZLA 4O49A 5G26A 4AYEC 1ZHZA 2Y0HA 4FOZA 2LHFA 4FT6A 2OMFA 2LFUA 2J1NA 4G75A 4AYDC 3DWNA 5DL5A 2KZ7B 4FESA 3HOEA 3PGRA 4LSIA 4PJ0O 4PR7A 4RLBA 3AA7B 3T24A 4CTDA 1OSMA 2R4PA 3HW9A 5KAFO 4D5UA 2KDYA 4KR8A 4LSFA 5EE2A 5JDPA 4KRAA 3UAQA 5DL6A 3AA1A 4D65A 4O4XA 1ORMA 1H6S1 1HXUA 2PORA 2ERVA 1BH3A 2JQYA 1GFPA 3AAEB 3AA6B 3LK2A 7PRNA 4E1TA 2K4TA 3POXA 4PUXA 5B5EO 3RBHA 1BT9A 3DA4A 3TZGA 2R8AA 3UU2A 5IYUA 2Y7SA 3V8UA 2R4OA 1OPFA 4O3YA 1G90A 2W80C 5ADXL 3PORA 2MNHA 2XE1A 2XTRA 3BS0A 3SZDA 2IWWA 3GP6A 5G3AA 4UB8O 1ZHXA 3A0BO 2XG6A 2M06A 1GFNA 3DA3A 1PHOA 2R89A 2XMXA 3VE1A 5DL8A 3SY9A 5G38A 4O3XB 4O3WA 4C00A 4JCHA 2QTKA 2N2LA 2YNKA 3LK41 3UPGA 3AA1B 3WU2O 4AKRA 2WVPA 3C5OA 2WJQA 3LK2B 2KXPA 5E79O 5D5DA 3WI4A 5GTHO 5AFUK 5H2FO 3POUA 2F1TA 2J4UP 1MM5A 4K3BA 1YS5A 1T16A 5T5FA 4O4UA 1BXWA 1T1LA 3VZUX 3QRAA 2N2MA 1GFMA 4FRTA 4GHBA 4IL6O 4BUMX 2F1VA 1GFOA 3AAAA 2R4LA 2FGRA 4FMSA 1E54A 4RLCA 3SY7A 3VY9X 5PRNA 3VY8X 2R4NA 2Y2XA 4C69X 3AA0A 3PQSA 2K0LA 1S5LO 2W81C 3G7GA 4GCQA 4LSEA 4RJXA 4G76A 3VZWX 3SZVA 2R88A 3HWBA 3BRYA 5KAIO 4N58A 3JCUO 4F4BA 2ODJA 2YPVA 4FRXA 5DL7A 3HOLA 2Y0LA 4AKRB 1HXXA 2M07A 2X27X 8PRNA 4UB6O 1QJ9A 6PRNA 5GV0A 3FYXA 4QQ1A 3EMNX 3KZIO 4GF4A 2XTQA 3WI5A 3QRCA 4FQEA 2XE5A 2ZLDA 3A2SX 2XE3A 4N75A 4C4VA 1Q9GA 4FSOA 3JTYA 4AKMA 3AA6A 4U9CA 4FSPA 5FVNA 2MHLA 4K3CA 4JFBA 1MM4A 3AA0B 3O0EA 4E1SA 4KR4A 2FGQX 1Q9FA 2GE4A 5AFUL 1IZNA 3DWOX 4XNKA 2F1CX 2O4VA 4GCSA 3BRZA 4XNLA 3VE2A 1THQA 1ZHWA 4GCPA 5GTIO 3LK3A 4AFKA 2XE2A 4FUVA
chains in the Genus database with same CATH topology
2KC0A 3T0SA 4B61A 4LSHA 1HXTA 3PQUA 2KZ7A 1ZHYA 3PRNA 3AA7A 3SYSA 1GFQA 2KXPB 3T20A 2PRNA 1QJ8A 4Z3TA 4AYMC 1QJPA 1ZHTA 5ADXK 3K19A 4RJWA 1PRNA 4AUIA 1P4TA 3AAAB 4RL9A 3SYBA 2ZFGA 3KVDD 3AAEA 4N59A 4AYNA 4AZLA 2JMMA 3LK42 4D64A 1IZNB 1MPFA 2Y0KA 3VZTX 4AYID 3POQA 4FZNA 4O3ZA 3LK3B 3NSGA 4FZMA 4FZLA 4O49A 5G26A 4AYEC 1ZHZA 2Y0HA 4FOZA 2LHFA 4FT6A 2OMFA 2LFUA 2J1NA 4G75A 4AYDC 5DL5A 2KZ7B 4FESA 3HOEA 4LSIA 4RLBA 3AA7B 3T24A 1OSMA 3HW9A 4D5UA 2KDYA 4KR8A 4LSFA 5EE2A 5JDPA 4KRAA 3UAQA 5DL6A 3AA1A 4D65A 4O4XA 1ORMA 1H6S1 1HXUA 2ERVA 2PORA 1BH3A 3AAEB 1GFPA 3LK2A 3AA6B 7PRNA 4E1TA 2K4TA 3POXA 4PUXA 3RBHA 1BT9A 3DA4A 3TZGA 3UU2A 5IYUA 2Y7SA 3V8UA 1OPFA 4O3YA 1G90A 2W80C 5ADXL 3PORA 2MNHA 2XE1A 2XTRA 3SZDA 3GP6A 1ZHXA 2XG6A 2M06A 1GFNA 3DA3A 1PHOA 2XMXA 3VE1A 5DL8A 3SY9A 4O3XB 4O3WA 4JCHA 2QTKA 2N2LA 2YNKA 3LK41 3UPGA 3AA1B 4AKRA 3C5OA 3LK2B 2KXPA 5D5DA 3WI4A 5AFUK 3POUA 2F1TA 2J4UP 1MM5A 1YS5A 3VZUX 5T5FA 4O4UA 1BXWA 3QRAA 2N2MA 1GFMA 4FRTA 4GHBA 4BUMX 2F1VA 1GFOA 3AAAA 4FMSA 2FGRA 4RLCA 1E54A 3SY7A 3VY9X 5PRNA 3VY8X 2Y2XA 4C69X 3AA0A 3PQSA 2K0LA 4GCQA 2W81C 3G7GA 4LSEA 4RJXA 3VZWX 4G76A 3SZVA 3HWBA 4N58A 4F4BA 2ODJA 2YPVA 4FRXA 5DL7A 3HOLA 2Y0LA 4AKRB 1HXXA 2M07A 2X27X 8PRNA 1QJ9A 6PRNA 5GV0A 3FYXA 4QQ1A 3EMNX 4GF4A 2XTQA 3WI5A 3QRCA 2XE5A 2ZLDA 3A2SX 2XE3A 1Q9GA 4FSOA 3JTYA 4AKMA 3AA6A 4U9CA 4FSPA 5FVNA 2MHLA 4JFBA 1MM4A 3AA0B 3O0EA 4E1SA 4KR4A 2FGQX 1Q9FA 2GE4A 5AFUL 1IZNA 4XNKA 4XNLA 2O4VA 4GCSA 3VE2A 1THQA 1ZHWA 4GCPA 4AFKA 3LK3A 2XE2A 4FUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0S A;  4LSH A;  1HXT A;  3PRN A;  3SYS A;  1GFQ A;  3T20 A;  2PRN A;  3K19 A;  4RJW A;  1PRN A;  4AUI A;  3SYB A;  5JDP A;  2ZFG A;  4D64 A;  1MPF A;  2Y0K A;  3VZT X;  3POQ A;  3NSG A;  2Y0H A;  4FOZ A;  4FT6 A;  2OMF A;  2J1N A;  5DL5 A;  4LSI A;  3T24 A;  1OSM A;  3HW9 A;  4D5U A;  4KR8 A;  4LSF A;  4KRA A;  5DL6 A;  4D65 A;  1H6S 1;  1HXU A;  2POR A;  1BH3 A;  1GFP A;  7PRN A;  2K4T A;  3POX A;  3UU2 A;  1BT9 A;  1OPF A;  3POR A;  2XE1 A;  3SZD A;  2XG6 A;  1GFN A;  1PHO A;  5DL8 A;  3SY9 A;  2QTK A;  3UPG A;  3WI4 A;  3POU A;  2J4U P;  3VZU X;  4FRT A;  4BUM X;  1GFM A;  4FMS A;  1GFO A;  2FGR A;  3VY9 X;  1E54 A;  3SY7 A;  5PRN A;  3VY8 X;  2Y2X A;  4C69 X;  4GCQ A;  4LSE A;  4RJX A;  3VZW X;  3SZV A;  3HWB A;  2ODJ A;  5DL7 A;  4FRX A;  2Y0L A;  1HXX A;  8PRN A;  6PRN A;  3FYX A;  3EMN X;  3WI5 A;  2XE5 A;  2ZLD A;  3A2S X;  2XE3 A;  4FSO A;  3JTY A;  4FSP A;  5FVN A;  4JFB A;  3O0E A;  4KR4 A;  2FGQ X;  2O4V A;  4GCS A;  4GCP A;  2XE2 A; 
#chains in the Genus database with same CATH topology
 2KC0 A;  3T0S A;  2IWV A;  4B61 A;  4LSH A;  1HXT A;  3PQU A;  2KZ7 A;  1ZHY A;  5B66 O;  3PRN A;  3AA7 A;  3SYS A;  1GFQ A;  2KXP B;  3PGS A;  3T20 A;  4C4V B;  5G39 A;  2PRN A;  1QJ8 A;  3DZM A;  4Z3T A;  4AYM C;  1QJP A;  1ZHT A;  5ADX K;  3K19 A;  4RJW A;  3PGU A;  4N74 A;  1PRN A;  4AUI A;  3NJT A;  1P4T A;  3AAA B;  4RL9 A;  3SYB A;  2ZFG A;  3KVD D;  3AAE A;  4N59 A;  4AYN A;  4AZL A;  2JMM A;  3LK4 2;  4D64 A;  5TIS O;  2WJR A;  3PF1 A;  2AXT O;  1IZN B;  1MPF A;  2X9K A;  2Y0K A;  3VZT X;  3A0H O;  4AYI D;  3POQ A;  4FZN A;  4O3Z A;  3LK3 B;  3NSG A;  4FZM A;  4FZL A;  4O49 A;  5G26 A;  4AYE C;  1ZHZ A;  2Y0H A;  4FOZ A;  2LHF A;  4FT6 A;  2OMF A;  2LFU A;  2J1N A;  4G75 A;  4AYD C;  3DWN A;  5DL5 A;  2KZ7 B;  4FES A;  3HOE A;  3PGR A;  4LSI A;  4PJ0 O;  4PR7 A;  4RLB A;  3AA7 B;  3T24 A;  4CTD A;  1OSM A;  2R4P A;  3HW9 A;  5KAF O;  4D5U A;  2KDY A;  4KR8 A;  4LSF A;  5EE2 A;  5JDP A;  4KRA A;  3UAQ A;  5DL6 A;  3AA1 A;  4D65 A;  4O4X A;  1ORM A;  1H6S 1;  1HXU A;  2POR A;  2ERV A;  1BH3 A;  2JQY A;  1GFP A;  3AAE B;  3AA6 B;  3LK2 A;  7PRN A;  4E1T A;  2K4T A;  3POX A;  4PUX A;  5B5E O;  3RBH A;  1BT9 A;  3DA4 A;  3TZG A;  2R8A A;  3UU2 A;  5IYU A;  2Y7S A;  3V8U A;  2R4O A;  1OPF A;  4O3Y A;  1G90 A;  2W80 C;  5ADX L;  3POR A;  2MNH A;  2XE1 A;  2XTR A;  3BS0 A;  3SZD A;  2IWW A;  3GP6 A;  5G3A A;  4UB8 O;  1ZHX A;  3A0B O;  2XG6 A;  2M06 A;  1GFN A;  3DA3 A;  1PHO A;  2R89 A;  2XMX A;  3VE1 A;  5DL8 A;  3SY9 A;  5G38 A;  4O3X B;  4O3W A;  4C00 A;  4JCH A;  2QTK A;  2N2L A;  2YNK A;  3LK4 1;  3UPG A;  3AA1 B;  3WU2 O;  4AKR A;  2WVP A;  3C5O A;  2WJQ A;  3LK2 B;  2KXP A;  5E79 O;  5D5D A;  3WI4 A;  5GTH O;  5AFU K;  5H2F O;  3POU A;  2F1T A;  2J4U P;  1MM5 A;  4K3B A;  1YS5 A;  1T16 A;  5T5F A;  4O4U A;  1BXW A;  1T1L A;  3VZU X;  3QRA A;  2N2M A;  1GFM A;  4FRT A;  4GHB A;  4IL6 O;  4BUM X;  2F1V A;  1GFO A;  3AAA A;  2R4L A;  2FGR A;  4FMS A;  1E54 A;  4RLC A;  3SY7 A;  3VY9 X;  5PRN A;  3VY8 X;  2R4N A;  2Y2X A;  4C69 X;  3AA0 A;  3PQS A;  2K0L A;  1S5L O;  2W81 C;  3G7G A;  4GCQ A;  4LSE A;  4RJX A;  4G76 A;  3VZW X;  3SZV A;  2R88 A;  3HWB A;  3BRY A;  5KAI O;  4N58 A;  3JCU O;  4F4B A;  2ODJ A;  2YPV A;  4FRX A;  5DL7 A;  3HOL A;  2Y0L A;  4AKR B;  1HXX A;  2M07 A;  2X27 X;  8PRN A;  4UB6 O;  1QJ9 A;  6PRN A;  5GV0 A;  3FYX A;  4QQ1 A;  3EMN X;  3KZI O;  4GF4 A;  2XTQ A;  3WI5 A;  3QRC A;  4FQE A;  2XE5 A;  2ZLD A;  3A2S X;  2XE3 A;  4N75 A;  4C4V A;  1Q9G A;  4FSO A;  3JTY A;  4AKM A;  3AA6 A;  4U9C A;  4FSP A;  5FVN A;  2MHL A;  4K3C A;  4JFB A;  1MM4 A;  3AA0 B;  3O0E A;  4E1S A;  4KR4 A;  2FGQ X;  1Q9F A;  2GE4 A;  5AFU L;  1IZN A;  3DWO X;  4XNK A;  2F1C X;  2O4V A;  4GCS A;  3BRZ A;  4XNL A;  3VE2 A;  1THQ A;  1ZHW A;  4GCP A;  5GTI O;  3LK3 A;  4AFK A;  2XE2 A;  4FUV A; 
#chains in the Genus database with same CATH homology
 2KC0 A;  3T0S A;  4B61 A;  4LSH A;  1HXT A;  3PQU A;  2KZ7 A;  1ZHY A;  3PRN A;  3AA7 A;  3SYS A;  1GFQ A;  2KXP B;  3T20 A;  2PRN A;  1QJ8 A;  4Z3T A;  4AYM C;  1QJP A;  1ZHT A;  5ADX K;  3K19 A;  4RJW A;  1PRN A;  4AUI A;  1P4T A;  3AAA B;  4RL9 A;  3SYB A;  2ZFG A;  3KVD D;  3AAE A;  4N59 A;  4AYN A;  4AZL A;  2JMM A;  3LK4 2;  4D64 A;  1IZN B;  1MPF A;  2Y0K A;  3VZT X;  4AYI D;  3POQ A;  4FZN A;  4O3Z A;  3LK3 B;  3NSG A;  4FZM A;  4FZL A;  4O49 A;  5G26 A;  4AYE C;  1ZHZ A;  2Y0H A;  4FOZ A;  2LHF A;  4FT6 A;  2OMF A;  2LFU A;  2J1N A;  4G75 A;  4AYD C;  5DL5 A;  2KZ7 B;  4FES A;  3HOE A;  4LSI A;  4RLB A;  3AA7 B;  3T24 A;  1OSM A;  3HW9 A;  4D5U A;  2KDY A;  4KR8 A;  4LSF A;  5EE2 A;  5JDP A;  4KRA A;  3UAQ A;  5DL6 A;  3AA1 A;  4D65 A;  4O4X A;  1ORM A;  1H6S 1;  1HXU A;  2ERV A;  2POR A;  1BH3 A;  3AAE B;  1GFP A;  3LK2 A;  3AA6 B;  7PRN A;  4E1T A;  2K4T A;  3POX A;  4PUX A;  3RBH A;  1BT9 A;  3DA4 A;  3TZG A;  3UU2 A;  5IYU A;  2Y7S A;  3V8U A;  1OPF A;  4O3Y A;  1G90 A;  2W80 C;  5ADX L;  3POR A;  2MNH A;  2XE1 A;  2XTR A;  3SZD A;  3GP6 A;  1ZHX A;  2XG6 A;  2M06 A;  1GFN A;  3DA3 A;  1PHO A;  2XMX A;  3VE1 A;  5DL8 A;  3SY9 A;  4O3X B;  4O3W A;  4JCH A;  2QTK A;  2N2L A;  2YNK A;  3LK4 1;  3UPG A;  3AA1 B;  4AKR A;  3C5O A;  3LK2 B;  2KXP A;  5D5D A;  3WI4 A;  5AFU K;  3POU A;  2F1T A;  2J4U P;  1MM5 A;  1YS5 A;  3VZU X;  5T5F A;  4O4U A;  1BXW A;  3QRA A;  2N2M A;  1GFM A;  4FRT A;  4GHB A;  4BUM X;  2F1V A;  1GFO A;  3AAA A;  4FMS A;  2FGR A;  4RLC A;  1E54 A;  3SY7 A;  3VY9 X;  5PRN A;  3VY8 X;  2Y2X A;  4C69 X;  3AA0 A;  3PQS A;  2K0L A;  4GCQ A;  2W81 C;  3G7G A;  4LSE A;  4RJX A;  3VZW X;  4G76 A;  3SZV A;  3HWB A;  4N58 A;  4F4B A;  2ODJ A;  2YPV A;  4FRX A;  5DL7 A;  3HOL A;  2Y0L A;  4AKR B;  1HXX A;  2M07 A;  2X27 X;  8PRN A;  1QJ9 A;  6PRN A;  5GV0 A;  3FYX A;  4QQ1 A;  3EMN X;  4GF4 A;  2XTQ A;  3WI5 A;  3QRC A;  2XE5 A;  2ZLD A;  3A2S X;  2XE3 A;  1Q9G A;  4FSO A;  3JTY A;  4AKM A;  3AA6 A;  4U9C A;  4FSP A;  5FVN A;  2MHL A;  4JFB A;  1MM4 A;  3AA0 B;  3O0E A;  4E1S A;  4KR4 A;  2FGQ X;  1Q9F A;  2GE4 A;  5AFU L;  1IZN A;  4XNK A;  4XNL A;  2O4V A;  4GCS A;  3VE2 A;  1THQ A;  1ZHW A;  4GCP A;  4AFK A;  3LK3 A;  2XE2 A;  4FUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...