6PRNA

E1m, k50a, r52a mutant of rh. blastica porin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAALAMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 6prnA00
2ODJA 5JDPA 2Y0HA 3POUA 1HXTA 3K19A 3POXA 4D5UA 3UPGA 8PRNA 1GFNA 2Y0KA 1OSMA 1PRNA 4D65A 6PRNA 1OPFA 2Y2XA 2ZFGA 2XE5A 1GFMA 1PHOA 2PRNA 2J4UP 2FGRA 3SYBA 4GCPA 4KR8A 2QTKA 2J1NA 3VZWX 4KR4A 3VY9X 2XE1A 3SZVA 3JTYA 1MPFA 3FYXA 2ZLDA 3POQA 4JFBA 1HXXA 3EMNX 4C69X 4FMSA 4FOZA 3HW9A 4KRAA 4AUIA 3T20A 1HXUA 4BUMX 4FSPA 4LSHA 1BT9A 4RJXA 7PRNA 4LSFA 5DL8A 3PORA 3VZTX 3NSGA 5DL7A 3SZDA 1E54A 4D64A 3PRNA 4GCQA 3VZUX 4FRTA 3HWBA 1BH3A 3SY7A 4LSEA 1GFOA 3T24A 3SYSA 1H6S1 5PRNA 2XE2A 2K4TA 2XG6A 5FVNA 4FT6A 5DL5A 4FRXA 3A2SX 2FGQX 4RJWA 4LSIA 3UU2A 1GFPA 2PORA 1GFQA 2Y0LA 5DL6A 3SY9A 3WI5A 2O4VA 4FSOA 2OMFA 2XE3A 3WI4A 4GCSA 3VY8X 3O0EA 3T0SA
chains in the Genus database with same CATH superfamily
2W81C 5H2FO 1Q9GA 2ODJA 2Y0HA 3POUA 5JDPA 2KZ7B 3HOEA 4AYDC 4FZNA 3TZGA 3LK42 1HXTA 2WJQA 2WVPA 3K19A 4F4BA 3LK3A 3POXA 4K3BA 3LK3B 4D5UA 3UPGA 4E1TA 1ZHWA 3AA7A 8PRNA 4GHBA 3DZMA 2LHFA 2YPVA 4N75A 2LFUA 4Z3TA 1GFNA 2Y0KA 4C4VB 5AFUK 2KC0A 5TISO 3AA0A 2R88A 4AYMC 4FESA 2N2MA 1OSMA 5G3AA 1PRNA 1QJ9A 3BRZA 3G7GA 4RLBA 3A0HO 4AZLA 4D65A 4GF4A 1T1LA 3V8UA 6PRNA 1OPFA 3QRCA 2Y2XA 2ZFGA 2F1CX 2XE5A 4G75A 5B5EO 5ADXL 1GFMA 5GTIO 2JMMA 3DA3A 3AA0B 1PHOA 3AA1B 2PRNA 4XNKA 5KAIO 2R4LA 2KXPA 4N59A 4N58A 5T5FA 2R4OA 3AA6A 2J4UP 2FGRA 2Y7SA 3SYBA 4GCPA 2IWVA 4KR8A 1T16A 2QTKA 4PR7A 2YNKA 2J1NA 4O4XA 2MHLA 4RL9A 2MNHA 2WJRA 4KR4A 3VY9X 3VZWX 2XE1A 4AKRB 3SZVA 3JTYA 3AA6B 4O3YA 5GTHO 1MPFA 4PJ0O 4QQ1A 3FYXA 4FUVA 2ZLDA 3POQA 4U9CA 3RBHA 3PGSA 3PGRA 3LK2B 1MM5A 4JFBA 1HXXA 1QJPA 3NJTA 2ERVA 3KZIO 2R4PA 3EMNX 4B61A 4C69X 2IWWA 4FMSA 2R89A 1ZHXA 3PF1A 4O4UA 5AFUL 3UAQA 3DWOX 4FOZA 3HW9A 3JCUO 3PQSA 4KRAA 4AUIA 4FQEA 3T20A 1ORMA 1HXUA 2KZ7A 2GE4A 4UB8O 4FSPA 3HOLA 3VE2A 4LSHA 4JCHA 1BT9A 4RJXA 7PRNA 2XMXA 4LSFA 5IYUA 1ZHTA 4AKMA 5DL8A 3PORA 2M06A 3VZTX 4FZMA 3NSGA 5DL7A 1MM4A 5G39A 1E54A 3SZDA 4D64A 3PRNA 1G90A 4GCQA 3VZUX 2F1VA 4FRTA 2R8AA 3AA1A 5E79O 3HWBA 5G26A 1BH3A 2KXPB 3LK41 3SY7A 3AA7B 3QRAA 4LSEA 3VE1A 4AFKA 3KVDD 5G38A 1P4TA 4C00A 3DA4A 5GV0A 2N2LA 3C5OA 1GFOA 1BXWA 3AAAA 5KAFO 3T24A 2K0LA 3A0BO 3SYSA 4FZLA 1S5LO 4XNLA 1YS5A 1H6S1 2XE2A 3AAEB 3GP6A 3AAEA 5PRNA 2XTQA 4AYID 2K4TA 2X27X 2XG6A 3DWNA 4RLCA 5FVNA 4FT6A 2JQYA 2M07A 3PQUA 4E1SA 5DL5A 4O49A 4FRXA 3WU2O 3BS0A 4AKRA 3A2SX 4BUMX 2FGQX 5D5DA 3AAAB 4RJWA 3BRYA 4LSIA 3UU2A 4AYEC 1ZHYA 4K3CA 1GFPA 2KDYA 2PORA 2W80C 1GFQA 2Y0LA 4CTDA 3PGUA 5DL6A 4C4VA 4O3WA 1IZNB 3SY9A 4AYNA 1IZNA 1QJ8A 3WI5A 2R4NA 5ADXK 2O4VA 1Q9FA 4FSOA 4O3ZA 4UB6O 2OMFA 4PUXA 2XTRA 1ZHZA 2XE3A 5EE2A 3WI4A 4GCSA 3VY8X 2X9KA 3LK2A 4O3XB 5B66O 4N74A 2AXTO 3O0EA 3T0SA 1THQA 4G76A 2F1TA 4IL6O
chains in the Genus database with same CATH topology
2W81C 1Q9GA 2ODJA 2Y0HA 3POUA 5JDPA 2KZ7B 3HOEA 4AYDC 4FZNA 3TZGA 3LK42 1HXTA 3K19A 4F4BA 3LK3A 3POXA 3LK3B 4D5UA 3UPGA 4E1TA 1ZHWA 3AA7A 8PRNA 4GHBA 2LHFA 2YPVA 2LFUA 4Z3TA 1GFNA 2Y0KA 5AFUK 2KC0A 3AA0A 4AYMC 4FESA 2N2MA 1OSMA 1PRNA 1QJ9A 4RLBA 3G7GA 4AZLA 4D65A 6PRNA 4GF4A 3V8UA 1OPFA 3QRCA 2Y2XA 2ZFGA 2XE5A 4G75A 5ADXL 1GFMA 2JMMA 3DA3A 3AA0B 1PHOA 3AA1B 2PRNA 4XNKA 5T5FA 2KXPA 4N59A 4N58A 3AA6A 2J4UP 2FGRA 2Y7SA 3SYBA 4GCPA 4KR8A 2QTKA 2YNKA 2J1NA 4O4XA 2MHLA 4RL9A 2MNHA 4KR4A 3VZWX 3VY9X 2XE1A 4AKRB 3SZVA 3JTYA 3AA6B 4O3YA 1MPFA 4QQ1A 3FYXA 4FUVA 2ZLDA 3POQA 4U9CA 3RBHA 4JFBA 3LK2B 1MM5A 1HXXA 1QJPA 2ERVA 3EMNX 4B61A 4C69X 4FMSA 4O4UA 1ZHXA 5AFUL 3UAQA 4FOZA 3HW9A 4KRAA 3PQSA 4AUIA 3T20A 1ORMA 1HXUA 2KZ7A 2GE4A 4BUMX 4FSPA 3HOLA 3VE2A 4LSHA 4JCHA 1BT9A 4RJXA 7PRNA 2XMXA 4LSFA 5IYUA 1ZHTA 4AKMA 5DL8A 3PORA 2M06A 3VZTX 4FZMA 3NSGA 5DL7A 1MM4A 3SZDA 1E54A 4D64A 3PRNA 1G90A 4GCQA 3VZUX 2F1VA 4FRTA 3AA1A 3HWBA 5G26A 1BH3A 2KXPB 3LK41 3SY7A 3AA7B 3QRAA 4LSEA 3VE1A 4AFKA 3KVDD 1P4TA 3DA4A 5GV0A 2N2LA 3C5OA 1GFOA 1BXWA 3AAAA 3T24A 2K0LA 3SYSA 4FZLA 4XNLA 1YS5A 1H6S1 2XE2A 3AAEB 3GP6A 3AAEA 5PRNA 2XTQA 4AYID 2X27X 2K4TA 2XG6A 4RLCA 5FVNA 4FT6A 2M07A 4E1SA 3PQUA 5DL5A 4O49A 4FRXA 4AKRA 3A2SX 2FGQX 5D5DA 3AAAB 4RJWA 4LSIA 4AYEC 3UU2A 1ZHYA 1GFPA 2KDYA 2PORA 2W80C 1GFQA 2Y0LA 5DL6A 4O3WA 1IZNB 3SY9A 4AYNA 1IZNA 1QJ8A 3WI5A 5ADXK 2O4VA 1Q9FA 4FSOA 4O3ZA 2OMFA 4PUXA 2XTRA 1ZHZA 2XE3A 5EE2A 3WI4A 4GCSA 3VY8X 3LK2A 4O3XB 3O0EA 3T0SA 1THQA 4G76A 2F1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODJ A;  5JDP A;  2Y0H A;  3POU A;  1HXT A;  3K19 A;  3POX A;  4D5U A;  3UPG A;  8PRN A;  1GFN A;  2Y0K A;  1OSM A;  1PRN A;  4D65 A;  6PRN A;  1OPF A;  2Y2X A;  2ZFG A;  2XE5 A;  1GFM A;  1PHO A;  2PRN A;  2J4U P;  2FGR A;  3SYB A;  4GCP A;  4KR8 A;  2QTK A;  2J1N A;  3VZW X;  4KR4 A;  3VY9 X;  2XE1 A;  3SZV A;  3JTY A;  1MPF A;  3FYX A;  2ZLD A;  3POQ A;  4JFB A;  1HXX A;  3EMN X;  4C69 X;  4FMS A;  4FOZ A;  3HW9 A;  4KRA A;  4AUI A;  3T20 A;  1HXU A;  4BUM X;  4FSP A;  4LSH A;  1BT9 A;  4RJX A;  7PRN A;  4LSF A;  5DL8 A;  3POR A;  3VZT X;  3NSG A;  5DL7 A;  3SZD A;  1E54 A;  4D64 A;  3PRN A;  4GCQ A;  3VZU X;  4FRT A;  3HWB A;  1BH3 A;  3SY7 A;  4LSE A;  1GFO A;  3T24 A;  3SYS A;  1H6S 1;  5PRN A;  2XE2 A;  2K4T A;  2XG6 A;  5FVN A;  4FT6 A;  5DL5 A;  4FRX A;  3A2S X;  2FGQ X;  4RJW A;  4LSI A;  3UU2 A;  1GFP A;  2POR A;  1GFQ A;  2Y0L A;  5DL6 A;  3SY9 A;  3WI5 A;  2O4V A;  4FSO A;  2OMF A;  2XE3 A;  3WI4 A;  4GCS A;  3VY8 X;  3O0E A;  3T0S A; 
#chains in the Genus database with same CATH topology
 2W81 C;  5H2F O;  1Q9G A;  2ODJ A;  2Y0H A;  3POU A;  5JDP A;  2KZ7 B;  3HOE A;  4AYD C;  4FZN A;  3TZG A;  3LK4 2;  1HXT A;  2WJQ A;  2WVP A;  3K19 A;  4F4B A;  3LK3 A;  3POX A;  4K3B A;  3LK3 B;  4D5U A;  3UPG A;  4E1T A;  1ZHW A;  3AA7 A;  8PRN A;  4GHB A;  3DZM A;  2LHF A;  2YPV A;  4N75 A;  2LFU A;  4Z3T A;  1GFN A;  2Y0K A;  4C4V B;  5AFU K;  2KC0 A;  5TIS O;  3AA0 A;  2R88 A;  4AYM C;  4FES A;  2N2M A;  1OSM A;  5G3A A;  1PRN A;  1QJ9 A;  3BRZ A;  3G7G A;  4RLB A;  3A0H O;  4AZL A;  4D65 A;  4GF4 A;  1T1L A;  3V8U A;  6PRN A;  1OPF A;  3QRC A;  2Y2X A;  2ZFG A;  2F1C X;  2XE5 A;  4G75 A;  5B5E O;  5ADX L;  1GFM A;  5GTI O;  2JMM A;  3DA3 A;  3AA0 B;  1PHO A;  3AA1 B;  2PRN A;  4XNK A;  5KAI O;  2R4L A;  2KXP A;  4N59 A;  4N58 A;  5T5F A;  2R4O A;  3AA6 A;  2J4U P;  2FGR A;  2Y7S A;  3SYB A;  4GCP A;  2IWV A;  4KR8 A;  1T16 A;  2QTK A;  4PR7 A;  2YNK A;  2J1N A;  4O4X A;  2MHL A;  4RL9 A;  2MNH A;  2WJR A;  4KR4 A;  3VY9 X;  3VZW X;  2XE1 A;  4AKR B;  3SZV A;  3JTY A;  3AA6 B;  4O3Y A;  5GTH O;  1MPF A;  4PJ0 O;  4QQ1 A;  3FYX A;  4FUV A;  2ZLD A;  3POQ A;  4U9C A;  3RBH A;  3PGS A;  3PGR A;  3LK2 B;  1MM5 A;  4JFB A;  1HXX A;  1QJP A;  3NJT A;  2ERV A;  3KZI O;  2R4P A;  3EMN X;  4B61 A;  4C69 X;  2IWW A;  4FMS A;  2R89 A;  1ZHX A;  3PF1 A;  4O4U A;  5AFU L;  3UAQ A;  3DWO X;  4FOZ A;  3HW9 A;  3JCU O;  3PQS A;  4KRA A;  4AUI A;  4FQE A;  3T20 A;  1ORM A;  1HXU A;  2KZ7 A;  2GE4 A;  4UB8 O;  4FSP A;  3HOL A;  3VE2 A;  4LSH A;  4JCH A;  1BT9 A;  4RJX A;  7PRN A;  2XMX A;  4LSF A;  5IYU A;  1ZHT A;  4AKM A;  5DL8 A;  3POR A;  2M06 A;  3VZT X;  4FZM A;  3NSG A;  5DL7 A;  1MM4 A;  5G39 A;  1E54 A;  3SZD A;  4D64 A;  3PRN A;  1G90 A;  4GCQ A;  3VZU X;  2F1V A;  4FRT A;  2R8A A;  3AA1 A;  5E79 O;  3HWB A;  5G26 A;  1BH3 A;  2KXP B;  3LK4 1;  3SY7 A;  3AA7 B;  3QRA A;  4LSE A;  3VE1 A;  4AFK A;  3KVD D;  5G38 A;  1P4T A;  4C00 A;  3DA4 A;  5GV0 A;  2N2L A;  3C5O A;  1GFO A;  1BXW A;  3AAA A;  5KAF O;  3T24 A;  2K0L A;  3A0B O;  3SYS A;  4FZL A;  1S5L O;  4XNL A;  1YS5 A;  1H6S 1;  2XE2 A;  3AAE B;  3GP6 A;  3AAE A;  5PRN A;  2XTQ A;  4AYI D;  2K4T A;  2X27 X;  2XG6 A;  3DWN A;  4RLC A;  5FVN A;  4FT6 A;  2JQY A;  2M07 A;  3PQU A;  4E1S A;  5DL5 A;  4O49 A;  4FRX A;  3WU2 O;  3BS0 A;  4AKR A;  3A2S X;  4BUM X;  2FGQ X;  5D5D A;  3AAA B;  4RJW A;  3BRY A;  4LSI A;  3UU2 A;  4AYE C;  1ZHY A;  4K3C A;  1GFP A;  2KDY A;  2POR A;  2W80 C;  1GFQ A;  2Y0L A;  4CTD A;  3PGU A;  5DL6 A;  4C4V A;  4O3W A;  1IZN B;  3SY9 A;  4AYN A;  1IZN A;  1QJ8 A;  3WI5 A;  2R4N A;  5ADX K;  2O4V A;  1Q9F A;  4FSO A;  4O3Z A;  4UB6 O;  2OMF A;  4PUX A;  2XTR A;  1ZHZ A;  2XE3 A;  5EE2 A;  3WI4 A;  4GCS A;  3VY8 X;  2X9K A;  3LK2 A;  4O3X B;  5B66 O;  4N74 A;  2AXT O;  3O0E A;  3T0S A;  1THQ A;  4G76 A;  2F1T A;  4IL6 O; 
#chains in the Genus database with same CATH homology
 2W81 C;  1Q9G A;  2ODJ A;  2Y0H A;  3POU A;  5JDP A;  2KZ7 B;  3HOE A;  4AYD C;  4FZN A;  3TZG A;  3LK4 2;  1HXT A;  3K19 A;  4F4B A;  3LK3 A;  3POX A;  3LK3 B;  4D5U A;  3UPG A;  4E1T A;  1ZHW A;  3AA7 A;  8PRN A;  4GHB A;  2LHF A;  2YPV A;  2LFU A;  4Z3T A;  1GFN A;  2Y0K A;  5AFU K;  2KC0 A;  3AA0 A;  4AYM C;  4FES A;  2N2M A;  1OSM A;  1PRN A;  1QJ9 A;  4RLB A;  3G7G A;  4AZL A;  4D65 A;  6PRN A;  4GF4 A;  3V8U A;  1OPF A;  3QRC A;  2Y2X A;  2ZFG A;  2XE5 A;  4G75 A;  5ADX L;  1GFM A;  2JMM A;  3DA3 A;  3AA0 B;  1PHO A;  3AA1 B;  2PRN A;  4XNK A;  5T5F A;  2KXP A;  4N59 A;  4N58 A;  3AA6 A;  2J4U P;  2FGR A;  2Y7S A;  3SYB A;  4GCP A;  4KR8 A;  2QTK A;  2YNK A;  2J1N A;  4O4X A;  2MHL A;  4RL9 A;  2MNH A;  4KR4 A;  3VZW X;  3VY9 X;  2XE1 A;  4AKR B;  3SZV A;  3JTY A;  3AA6 B;  4O3Y A;  1MPF A;  4QQ1 A;  3FYX A;  4FUV A;  2ZLD A;  3POQ A;  4U9C A;  3RBH A;  4JFB A;  3LK2 B;  1MM5 A;  1HXX A;  1QJP A;  2ERV A;  3EMN X;  4B61 A;  4C69 X;  4FMS A;  4O4U A;  1ZHX A;  5AFU L;  3UAQ A;  4FOZ A;  3HW9 A;  4KRA A;  3PQS A;  4AUI A;  3T20 A;  1ORM A;  1HXU A;  2KZ7 A;  2GE4 A;  4BUM X;  4FSP A;  3HOL A;  3VE2 A;  4LSH A;  4JCH A;  1BT9 A;  4RJX A;  7PRN A;  2XMX A;  4LSF A;  5IYU A;  1ZHT A;  4AKM A;  5DL8 A;  3POR A;  2M06 A;  3VZT X;  4FZM A;  3NSG A;  5DL7 A;  1MM4 A;  3SZD A;  1E54 A;  4D64 A;  3PRN A;  1G90 A;  4GCQ A;  3VZU X;  2F1V A;  4FRT A;  3AA1 A;  3HWB A;  5G26 A;  1BH3 A;  2KXP B;  3LK4 1;  3SY7 A;  3AA7 B;  3QRA A;  4LSE A;  3VE1 A;  4AFK A;  3KVD D;  1P4T A;  3DA4 A;  5GV0 A;  2N2L A;  3C5O A;  1GFO A;  1BXW A;  3AAA A;  3T24 A;  2K0L A;  3SYS A;  4FZL A;  4XNL A;  1YS5 A;  1H6S 1;  2XE2 A;  3AAE B;  3GP6 A;  3AAE A;  5PRN A;  2XTQ A;  4AYI D;  2X27 X;  2K4T A;  2XG6 A;  4RLC A;  5FVN A;  4FT6 A;  2M07 A;  4E1S A;  3PQU A;  5DL5 A;  4O49 A;  4FRX A;  4AKR A;  3A2S X;  2FGQ X;  5D5D A;  3AAA B;  4RJW A;  4LSI A;  4AYE C;  3UU2 A;  1ZHY A;  1GFP A;  2KDY A;  2POR A;  2W80 C;  1GFQ A;  2Y0L A;  5DL6 A;  4O3W A;  1IZN B;  3SY9 A;  4AYN A;  1IZN A;  1QJ8 A;  3WI5 A;  5ADX K;  2O4V A;  1Q9F A;  4FSO A;  4O3Z A;  2OMF A;  4PUX A;  2XTR A;  1ZHZ A;  2XE3 A;  5EE2 A;  3WI4 A;  4GCS A;  3VY8 X;  3LK2 A;  4O3X B;  3O0E A;  3T0S A;  1THQ A;  4G76 A;  2F1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...