6PRNA

E1m, k50a, r52a mutant of rh. blastica porin
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
289
structure length
289
Chain Sequence
MISLNGYGRFGLQYVEDRGVGLEDTIISSRLRINIVGTTETDQGVTFGAALAMQWDDGDAFAGTAGNAAQFWTSYNGVTVSVGNVDTAFDSVALTYDSEMGYEASSFGDAQSSFFAYNSKYDASGALDNYNGIAVTYSISGVNLYLSYVDPDQTVDSSLVTEEFGIAADWSNDMISLAAAYTTDAGGIVDNDIAFVGAAYKFNDAGTVGLNWYDNGLSTAGDQVTLYGNYAFGATTVRAYVSDIDRAGADTAYGIGADYQFAEGVKVSGSVQSGFANETVADVGVRFDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Porin mutants with new channel properties.
pubmed rcsb
source organism Rhodobacter blasticus
molecule tags Membrane protein
molecule keywords PORIN
total genus 76
structure length 289
sequence length 289
ec nomenclature
pdb deposition date 1998-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.160.10 Mainly Beta Beta Barrel Porin Porin 6prnA00
3EMNX 3T20A 3UPGA 4GCSA 4LSEA 1GFPA 2XE1A 1HXUA 2Y0LA 3POXA 3T24A 3VZTX 4KRAA 2XE5A 4FMSA 4KR8A 3VY9X 5DL8A 4RJWA 3POQA 7PRNA 1PRNA 2FGQX 2O4VA 2J4UP 1E54A 3HW9A 3O0EA 3SZDA 4D64A 2ODJA 3VZUX 2QTKA 1GFMA 2XE3A 5DL6A 1GFQA 5DL7A 2ZFGA 2XE2A 4AUIA 1BT9A 3PRNA 4FT6A 2PORA 2Y0HA 3A2SX 2OMFA 4BUMX 2PRNA 3UU2A 8PRNA 3HWBA 4JFBA 4FRXA 4LSIA 1BH3A 4GCPA 4FSPA 2Y0KA 4C69X 5PRNA 1MPFA 1HXXA 3WI5A 1PHOA 3K19A 4FRTA 3JTYA 3T0SA 4FSOA 3SYSA 6PRNA 2FGRA 1OPFA 2XG6A 4D65A 4LSHA 5JDPA 2J1NA 5DL5A 3SYBA 4GCQA 3SY7A 3NSGA 3FYXA 4KR4A 3SZVA 1GFNA 1GFOA 3POUA 1HXTA 5FVNA 3PORA 2K4TA 1OSMA 2Y2XA 3WI4A 1H6S1 3VY8X 4LSFA 4RJXA 4FOZA 2ZLDA 4D5UA 3SY9A 3VZWX
chains in the Genus database with same CATH superfamily
3EMNX 3AA6B 4AYMC 2N2LA 2KZ7B 3T20A 3UPGA 3AA0A 3G7GA 2F1VA 2WJRA 2K0LA 8PRNA 3PGRA 4GCSA 4LSEA 1GFPA 1QJ9A 3BRZA 5GV0A 1MM4A 2XE1A 5H2FO 1HXUA 2Y0LA 3AA7B 2N2MA 3POXA 4QQ1A 3T24A 4AYDC 3VZTX 4KRAA 3PQUA 2XE5A 3GP6A 4FUVA 2IWWA 4FMSA 3AAEA 5G3AA 5B66O 1QJPA 2R4PA 3BS0A 4KR8A 2MHLA 4PJ0O 3VY9X 3V8UA 2AXTO 4O49A 5DL8A 4G76A 1IZNA 4O3WA 2X27X 3AA1B 3POQA 1PRNA 2FGQX 4RJWA 7PRNA 3AAEB 1ZHWA 2O4VA 4G75A 1T16A 4UB6O 4FESA 2J4UP 1E54A 3HW9A 3O0EA 4RL9A 2JMMA 5G26A 3SZDA 4D64A 3LK41 2ODJA 1T1LA 3VZUX 4FQEA 3AA0B 2QTKA 1GFMA 2R4NA 5GTIO 2XE3A 2Y7SA 3AA6A 4RLBA 4E1TA 5DL6A 1GFQA 2KXPA 5DL7A 3LK3A 2ZFGA 2XE2A 3PGSA 1BT9A 4JCHA 4AUIA 3QRCA 3DA3A 3PRNA 3RBHA 3VE2A 2R4LA 3PGUA 4K3BA 4N74A 2GE4A 4FT6A 4AZLA 2XTRA 2M06A 3AA7A 3DA4A 2PORA 2KXPB 4C4VB 2Y0HA 3BRYA 4XNLA 5TISO 1G90A 1ZHTA 3A2SX 3KVDD 4O3YA 1YS5A 2OMFA 2PRNA 1P4TA 2JQYA 3LK3B 4K3CA 3HWBA 1ZHZA 4JFBA 4O3ZA 5D5DA 3UU2A 4FRXA 5G39A 3QRAA 5ADXL 4LSIA 4CTDA 4BUMX 4N59A 2M07A 1BH3A 4GCPA 3C5OA 4O4UA 4FSPA 3JCUO 2Y0KA 4C69X 2ERVA 5E79O 1MPFA 5PRNA 4AYEC 1HXXA 3WI5A 4B61A 5AFUK 4PUXA 1PHOA 2R8AA 4O3XB 3K19A 3HOEA 4FRTA 3PQSA 1Q9GA 3JTYA 3T0SA 3TZGA 4FSOA 3LK2B 3SYSA 6PRNA 3AAAB 2F1TA 4AKRB 4RLCA 2FGRA 3NJTA 1BXWA 1OPFA 4FZNA 3A0HO 4N75A 4C00A 2R4OA 2XG6A 4D65A 2KZ7A 4LSHA 4Z3TA 5JDPA 2J1NA 2X9KA 1Q9FA 5DL5A 5T5FA 3SYBA 2XMXA 4GCQA 4AFKA 1QJ8A 4AYNA 3SY7A 4C4VA 3NSGA 3FYXA 4KR4A 3SZVA 2MNHA 3A0BO 1GFNA 3LK42 4UB8O 4GF4A 1GFOA 4PR7A 1S5LO 4AYID 2LFUA 2LHFA 3POUA 2F1CX 3DWOX 1HXTA 3KZIO 3AA1A 3LK2A 2W81C 3AAAA 1THQA 4AKRA 1ORMA 2YPVA 4XNKA 5FVNA 4E1SA 4O4XA 2W80C 3HOLA 3UAQA 5B5EO 5KAIO 3PORA 2R89A 4FZLA 2K4TA 1ZHXA 2R88A 2XTQA 2KC0A 5GTHO 2WJQA 1OSMA 2Y2XA 3DWNA 3WI4A 4AKMA 1H6S1 3DZMA 1MM5A 5AFUL 2KDYA 3VY8X 5IYUA 2YNKA 5G38A 1IZNB 4LSFA 1ZHYA 4IL6O 4RJXA 2IWVA 4FOZA 4U9CA 4F4BA 2ZLDA 4D5UA 3SY9A 5ADXK 4GHBA 2WVPA 5EE2A 3VE1A 3VZWX 4N58A 5KAFO 3PF1A 3WU2O 4FZMA
chains in the Genus database with same CATH topology
3EMNX 3AA6B 4AYMC 2N2LA 2KZ7B 3T20A 3UPGA 3AA0A 3G7GA 2F1VA 2K0LA 4GCSA 4LSEA 1GFPA 1QJ9A 5GV0A 1MM4A 2XE1A 2Y0LA 1HXUA 3AA7B 2N2MA 3POXA 4QQ1A 3T24A 4AYDC 3VZTX 4KRAA 3PQUA 2XE5A 3GP6A 4FUVA 4FMSA 3AAEA 1QJPA 4KR8A 2MHLA 3VY9X 3V8UA 4O49A 5DL8A 4G76A 1IZNA 4O3WA 2X27X 3AA1B 3POQA 1PRNA 2FGQX 4RJWA 7PRNA 3AAEB 1ZHWA 2O4VA 4G75A 4FESA 2J4UP 1E54A 3HW9A 3O0EA 4RL9A 2JMMA 5G26A 3SZDA 4D64A 3LK41 2ODJA 3VZUX 3AA0B 2QTKA 1GFMA 2XE3A 2Y7SA 3AA6A 4RLBA 4E1TA 5DL6A 1GFQA 2KXPA 5DL7A 3LK3A 2ZFGA 2XE2A 4AUIA 1BT9A 4JCHA 3QRCA 3DA3A 3PRNA 3RBHA 3VE2A 2GE4A 4FT6A 4AZLA 2XTRA 2M06A 3AA7A 3DA4A 2PORA 2KXPB 2Y0HA 4XNLA 1G90A 1ZHTA 3A2SX 3KVDD 4O3YA 1YS5A 2OMFA 2PRNA 1P4TA 3LK3B 3UU2A 4B61A 3HWBA 1ZHZA 4JFBA 4O3ZA 5D5DA 8PRNA 4FRXA 5ADXL 3QRAA 4LSIA 4BUMX 4N59A 2M07A 1BH3A 4GCPA 3C5OA 4O4UA 4FSPA 2Y0KA 4C69X 2ERVA 4AYEC 1MPFA 5PRNA 1HXXA 3WI5A 5AFUK 4PUXA 1PHOA 4O3XB 3K19A 3HOEA 4FRTA 3PQSA 1Q9GA 3JTYA 3T0SA 3TZGA 4FSOA 3LK2B 3SYSA 6PRNA 3AAAB 2F1TA 4AKRB 4RLCA 2FGRA 1BXWA 1OPFA 4FZNA 2XG6A 4D65A 2KZ7A 4LSHA 4Z3TA 5JDPA 2J1NA 5DL5A 1Q9FA 5T5FA 3SYBA 4AYNA 2XMXA 4GCQA 4AFKA 1QJ8A 3SY7A 3NSGA 3FYXA 4KR4A 3SZVA 2MNHA 1GFNA 3LK42 4GF4A 1GFOA 4AYID 2LFUA 2LHFA 3POUA 3LK2A 1HXTA 3AA1A 2W81C 3AAAA 1THQA 4AKRA 1ORMA 2YPVA 4XNKA 5FVNA 4E1SA 4O4XA 2W80C 3HOLA 3UAQA 3PORA 4FZLA 2K4TA 1ZHXA 2XTQA 2KC0A 4AKMA 1OSMA 2Y2XA 3WI4A 1H6S1 1MM5A 5AFUL 2KDYA 3VY8X 5IYUA 2YNKA 1IZNB 4LSFA 1ZHYA 4RJXA 4U9CA 4FOZA 4F4BA 2ZLDA 4D5UA 3SY9A 5ADXK 4GHBA 5EE2A 3VE1A 3VZWX 4N58A 4FZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EMN X;  3T20 A;  3UPG A;  4GCS A;  4LSE A;  1GFP A;  2XE1 A;  1HXU A;  2Y0L A;  3POX A;  3T24 A;  3VZT X;  4KRA A;  2XE5 A;  4FMS A;  4KR8 A;  3VY9 X;  5DL8 A;  4RJW A;  3POQ A;  7PRN A;  1PRN A;  2FGQ X;  2O4V A;  2J4U P;  1E54 A;  3HW9 A;  3O0E A;  3SZD A;  4D64 A;  2ODJ A;  3VZU X;  2QTK A;  1GFM A;  2XE3 A;  5DL6 A;  1GFQ A;  5DL7 A;  2ZFG A;  2XE2 A;  4AUI A;  1BT9 A;  3PRN A;  4FT6 A;  2POR A;  2Y0H A;  3A2S X;  2OMF A;  4BUM X;  2PRN A;  3UU2 A;  8PRN A;  3HWB A;  4JFB A;  4FRX A;  4LSI A;  1BH3 A;  4GCP A;  4FSP A;  2Y0K A;  4C69 X;  5PRN A;  1MPF A;  1HXX A;  3WI5 A;  1PHO A;  3K19 A;  4FRT A;  3JTY A;  3T0S A;  4FSO A;  3SYS A;  6PRN A;  2FGR A;  1OPF A;  2XG6 A;  4D65 A;  4LSH A;  5JDP A;  2J1N A;  5DL5 A;  3SYB A;  4GCQ A;  3SY7 A;  3NSG A;  3FYX A;  4KR4 A;  3SZV A;  1GFN A;  1GFO A;  3POU A;  1HXT A;  5FVN A;  3POR A;  2K4T A;  1OSM A;  2Y2X A;  3WI4 A;  1H6S 1;  3VY8 X;  4LSF A;  4RJX A;  4FOZ A;  2ZLD A;  4D5U A;  3SY9 A;  3VZW X; 
#chains in the Genus database with same CATH topology
 3EMN X;  3AA6 B;  4AYM C;  2N2L A;  2KZ7 B;  3T20 A;  3UPG A;  3AA0 A;  3G7G A;  2F1V A;  2WJR A;  2K0L A;  8PRN A;  3PGR A;  4GCS A;  4LSE A;  1GFP A;  1QJ9 A;  3BRZ A;  5GV0 A;  1MM4 A;  2XE1 A;  5H2F O;  1HXU A;  2Y0L A;  3AA7 B;  2N2M A;  3POX A;  4QQ1 A;  3T24 A;  4AYD C;  3VZT X;  4KRA A;  3PQU A;  2XE5 A;  3GP6 A;  4FUV A;  2IWW A;  4FMS A;  3AAE A;  5G3A A;  5B66 O;  1QJP A;  2R4P A;  3BS0 A;  4KR8 A;  2MHL A;  4PJ0 O;  3VY9 X;  3V8U A;  2AXT O;  4O49 A;  5DL8 A;  4G76 A;  1IZN A;  4O3W A;  2X27 X;  3AA1 B;  3POQ A;  1PRN A;  2FGQ X;  4RJW A;  7PRN A;  3AAE B;  1ZHW A;  2O4V A;  4G75 A;  1T16 A;  4UB6 O;  4FES A;  2J4U P;  1E54 A;  3HW9 A;  3O0E A;  4RL9 A;  2JMM A;  5G26 A;  3SZD A;  4D64 A;  3LK4 1;  2ODJ A;  1T1L A;  3VZU X;  4FQE A;  3AA0 B;  2QTK A;  1GFM A;  2R4N A;  5GTI O;  2XE3 A;  2Y7S A;  3AA6 A;  4RLB A;  4E1T A;  5DL6 A;  1GFQ A;  2KXP A;  5DL7 A;  3LK3 A;  2ZFG A;  2XE2 A;  3PGS A;  1BT9 A;  4JCH A;  4AUI A;  3QRC A;  3DA3 A;  3PRN A;  3RBH A;  3VE2 A;  2R4L A;  3PGU A;  4K3B A;  4N74 A;  2GE4 A;  4FT6 A;  4AZL A;  2XTR A;  2M06 A;  3AA7 A;  3DA4 A;  2POR A;  2KXP B;  4C4V B;  2Y0H A;  3BRY A;  4XNL A;  5TIS O;  1G90 A;  1ZHT A;  3A2S X;  3KVD D;  4O3Y A;  1YS5 A;  2OMF A;  2PRN A;  1P4T A;  2JQY A;  3LK3 B;  4K3C A;  3HWB A;  1ZHZ A;  4JFB A;  4O3Z A;  5D5D A;  3UU2 A;  4FRX A;  5G39 A;  3QRA A;  5ADX L;  4LSI A;  4CTD A;  4BUM X;  4N59 A;  2M07 A;  1BH3 A;  4GCP A;  3C5O A;  4O4U A;  4FSP A;  3JCU O;  2Y0K A;  4C69 X;  2ERV A;  5E79 O;  1MPF A;  5PRN A;  4AYE C;  1HXX A;  3WI5 A;  4B61 A;  5AFU K;  4PUX A;  1PHO A;  2R8A A;  4O3X B;  3K19 A;  3HOE A;  4FRT A;  3PQS A;  1Q9G A;  3JTY A;  3T0S A;  3TZG A;  4FSO A;  3LK2 B;  3SYS A;  6PRN A;  3AAA B;  2F1T A;  4AKR B;  4RLC A;  2FGR A;  3NJT A;  1BXW A;  1OPF A;  4FZN A;  3A0H O;  4N75 A;  4C00 A;  2R4O A;  2XG6 A;  4D65 A;  2KZ7 A;  4LSH A;  4Z3T A;  5JDP A;  2J1N A;  2X9K A;  1Q9F A;  5DL5 A;  5T5F A;  3SYB A;  2XMX A;  4GCQ A;  4AFK A;  1QJ8 A;  4AYN A;  3SY7 A;  4C4V A;  3NSG A;  3FYX A;  4KR4 A;  3SZV A;  2MNH A;  3A0B O;  1GFN A;  3LK4 2;  4UB8 O;  4GF4 A;  1GFO A;  4PR7 A;  1S5L O;  4AYI D;  2LFU A;  2LHF A;  3POU A;  2F1C X;  3DWO X;  1HXT A;  3KZI O;  3AA1 A;  3LK2 A;  2W81 C;  3AAA A;  1THQ A;  4AKR A;  1ORM A;  2YPV A;  4XNK A;  5FVN A;  4E1S A;  4O4X A;  2W80 C;  3HOL A;  3UAQ A;  5B5E O;  5KAI O;  3POR A;  2R89 A;  4FZL A;  2K4T A;  1ZHX A;  2R88 A;  2XTQ A;  2KC0 A;  5GTH O;  2WJQ A;  1OSM A;  2Y2X A;  3DWN A;  3WI4 A;  4AKM A;  1H6S 1;  3DZM A;  1MM5 A;  5AFU L;  2KDY A;  3VY8 X;  5IYU A;  2YNK A;  5G38 A;  1IZN B;  4LSF A;  1ZHY A;  4IL6 O;  4RJX A;  2IWV A;  4FOZ A;  4U9C A;  4F4B A;  2ZLD A;  4D5U A;  3SY9 A;  5ADX K;  4GHB A;  2WVP A;  5EE2 A;  3VE1 A;  3VZW X;  4N58 A;  5KAF O;  3PF1 A;  3WU2 O;  4FZM A; 
#chains in the Genus database with same CATH homology
 3EMN X;  3AA6 B;  4AYM C;  2N2L A;  2KZ7 B;  3T20 A;  3UPG A;  3AA0 A;  3G7G A;  2F1V A;  2K0L A;  4GCS A;  4LSE A;  1GFP A;  1QJ9 A;  5GV0 A;  1MM4 A;  2XE1 A;  2Y0L A;  1HXU A;  3AA7 B;  2N2M A;  3POX A;  4QQ1 A;  3T24 A;  4AYD C;  3VZT X;  4KRA A;  3PQU A;  2XE5 A;  3GP6 A;  4FUV A;  4FMS A;  3AAE A;  1QJP A;  4KR8 A;  2MHL A;  3VY9 X;  3V8U A;  4O49 A;  5DL8 A;  4G76 A;  1IZN A;  4O3W A;  2X27 X;  3AA1 B;  3POQ A;  1PRN A;  2FGQ X;  4RJW A;  7PRN A;  3AAE B;  1ZHW A;  2O4V A;  4G75 A;  4FES A;  2J4U P;  1E54 A;  3HW9 A;  3O0E A;  4RL9 A;  2JMM A;  5G26 A;  3SZD A;  4D64 A;  3LK4 1;  2ODJ A;  3VZU X;  3AA0 B;  2QTK A;  1GFM A;  2XE3 A;  2Y7S A;  3AA6 A;  4RLB A;  4E1T A;  5DL6 A;  1GFQ A;  2KXP A;  5DL7 A;  3LK3 A;  2ZFG A;  2XE2 A;  4AUI A;  1BT9 A;  4JCH A;  3QRC A;  3DA3 A;  3PRN A;  3RBH A;  3VE2 A;  2GE4 A;  4FT6 A;  4AZL A;  2XTR A;  2M06 A;  3AA7 A;  3DA4 A;  2POR A;  2KXP B;  2Y0H A;  4XNL A;  1G90 A;  1ZHT A;  3A2S X;  3KVD D;  4O3Y A;  1YS5 A;  2OMF A;  2PRN A;  1P4T A;  3LK3 B;  3UU2 A;  4B61 A;  3HWB A;  1ZHZ A;  4JFB A;  4O3Z A;  5D5D A;  8PRN A;  4FRX A;  5ADX L;  3QRA A;  4LSI A;  4BUM X;  4N59 A;  2M07 A;  1BH3 A;  4GCP A;  3C5O A;  4O4U A;  4FSP A;  2Y0K A;  4C69 X;  2ERV A;  4AYE C;  1MPF A;  5PRN A;  1HXX A;  3WI5 A;  5AFU K;  4PUX A;  1PHO A;  4O3X B;  3K19 A;  3HOE A;  4FRT A;  3PQS A;  1Q9G A;  3JTY A;  3T0S A;  3TZG A;  4FSO A;  3LK2 B;  3SYS A;  6PRN A;  3AAA B;  2F1T A;  4AKR B;  4RLC A;  2FGR A;  1BXW A;  1OPF A;  4FZN A;  2XG6 A;  4D65 A;  2KZ7 A;  4LSH A;  4Z3T A;  5JDP A;  2J1N A;  5DL5 A;  1Q9F A;  5T5F A;  3SYB A;  4AYN A;  2XMX A;  4GCQ A;  4AFK A;  1QJ8 A;  3SY7 A;  3NSG A;  3FYX A;  4KR4 A;  3SZV A;  2MNH A;  1GFN A;  3LK4 2;  4GF4 A;  1GFO A;  4AYI D;  2LFU A;  2LHF A;  3POU A;  3LK2 A;  1HXT A;  3AA1 A;  2W81 C;  3AAA A;  1THQ A;  4AKR A;  1ORM A;  2YPV A;  4XNK A;  5FVN A;  4E1S A;  4O4X A;  2W80 C;  3HOL A;  3UAQ A;  3POR A;  4FZL A;  2K4T A;  1ZHX A;  2XTQ A;  2KC0 A;  4AKM A;  1OSM A;  2Y2X A;  3WI4 A;  1H6S 1;  1MM5 A;  5AFU L;  2KDY A;  3VY8 X;  5IYU A;  2YNK A;  1IZN B;  4LSF A;  1ZHY A;  4RJX A;  4U9C A;  4FOZ A;  4F4B A;  2ZLD A;  4D5U A;  3SY9 A;  5ADX K;  4GHB A;  5EE2 A;  3VE1 A;  3VZW X;  4N58 A;  4FZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...