6RXNA

The structure of rubredoxin from desulfovibrio desulfuricans
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
45
structure length
45
Chain Sequence
MQKYVCNVCGYEYDPAEHDNVPFDQLPDDWCCPVCGVSKDQFSPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RUBREDOXIN
publication title The structure of rubredoxin from Desulfovibrio desulfuricans strain 27774 at 1.5 A resolution.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans
molecule tags Electron transfer(iron-sulfur protein)
total genus 8
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1990-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00301 Rubredoxin Rubredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.10 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 6rxnA00
1LKMA 1IU5A 1H7VA 1T9PA 1BE7A 2MS3A 1RB9A 1RDGA 1S2ZA 2RDVA 1IRNA 1S24A 1BQ8A 5AI3A 3RZTA 2M4YA 1BFYA 5AI2A 1R0FA 1YK5A 4RXNA 2KKDA 1E8JA 1FHMA 1BQ9A 3QVDA 1YUXA 2V3BB 1QCVA 2PVEA 1SMMA 1LTLA 1RYTA 3PWFA 2KN9A 1B2OA 2QL0A 3KYXA 1B71A 1LKPA 1YUZA 4AR4A 4YWLA 4TPUA 1NNQA 2PVXA 3PZAA 1T9QA 1T9OA 4POFA 4POGA 1DVBA 3RYGA 1CAAA 1R0GA 1CADA 1C09A 4K9FA 4YWMA 1ZRPA 4AR3A 2VL6A 8RXNA 1B2JA 4AR6A 1IU6A 2K2DA 1B13A 3KYYA 2LCQA 1RWDA 1FHHA 1R0HA 5RXNA 1LKOA 1YK4A 2PYAA 3RZ6A 3KYVA 4ME3A 1R0JA 1BRFA 1IROA 1VCXA 1QYBA 2DSXA 1SMUA 6RXNA 5IY0A 1DX8A 1YV1A 3A44A 2GMGA 2HR5A 7RXNA 3KYWA 3SS2A 4AR5A 1SMWA 1JYBA 3KYUA 1R0IA 3MPSA 1RDVA 1S30A
chains in the Genus database with same CATH superfamily
1LKMA 1BE7A 2MS3A 3HKZP 1S2ZA 4A3EL 2R93L 5MFPA 1S24A 4BY1L 3MQKB 2M4YA 2XJQA 1NXGA 5GADc 3J7Z1 4AYBP 4RXNA 2C6AA 2V3BB 2EY4E 5JVG1 2KN9A 4A3IL 3KYXA 3HOVL 1LKPA 3P2AA 1PZXA 3HAXC 2B5ID 5JVH1 2ERSA 4A3LL 2WAQP 5MGNA 4POGA 1R0GA 3RZOL 4K9FA 4JAEA 4G6BA 1NXEA 5C44L 2K2DA 2Z3RB 4AHXA 1RWDA 5IYCL 1Y1WL 4A3DL 2PYAA 3H99A 5GAGc 3PKIA 2H12A 2XJRA 2PPTA 4C2M1 5C4JL 1SFOL 2APOB 2A68D 3A44A 5M5WL 2GMGA 4AI2A 2NYDA 4C3JL 2WB1P 3S14L 4XXBB 3KYUA 1OWBA 4WFN1 3MPSA 1RDVA 4JAGA 4JADA 3P8BA 5C4XL 3MSUA 1T9PA 4V196 4B8CD 5DM61 4E6YA 1IRNA 5AI3A 1TWHL 3HOZL 1BFYA 2A69D 3S1QL 5H1Sc 1YK5A 1FHMA 3QVDA 1YUXA 3HJYB 1PFVA 4A3FL 4BBSL 1ODHA 3LWOB 1SMMA 4XGHA 3GTQL 3GTKL 3WWLA 2XJTA 2ZIXA 5M3FL 3M4OL 4BXXL 4ZN3B 2VUML 4A3CL 5IYBL 1I3QL 5EINC 4TPUA 3HOYL 1DVBA 5IYDL 4C3IL 1CADA 4YWMA 4AR3A 2NVYL 5M5YL 3B08B 2RFKB 5IP9L 1RYQA 2HVYC 1VZIA 2Y0SP 2AQCA 3HOXL 1I6HL 3HJWB 1LKOA 1YK4A 5FJ8L 4U671 4ME3A 4Y52L 2E2JL 3GTLL 1VCXA 5M3ML 5C3EL 4X6AL 5IY0A 2M6OA 5M5XL 4UY81 3S15L 2R7ZL 2NVQL 1TWGL 3PL5A 4AR5A 3I4ML 1WJVA 1JYBA 2M6PA 2JA8L 2A6HD 1S30A 4A3BL 1IU5A 4TVMA 3JR7A 3IU3I 3LWQB 1RDGA 2NVTL 2CKCA 1BQ8A 5AN9H 3GTML 5MF6A 2L0ZA 4C3HL 1R9TL 3LPEB 3LWRB 1R0FA 3S17L 2CR8A 2KKDA 2A6ED 2YU9L 5MFZA 3PIO1 4Y7NL 4JAFA 3S16L 1LTLA 3GTOL 2JA5L 4AHYA 2QL0A 1B71A 2J9UB 1Y1VL 3PIP1 1YUZA 2JA7L 4LHLA 3FDJA 1QQTA 2O5JD 4AR4A 2B63L 4YWLA 1PFUA 1NNQA 2PVXA 2BE5D 1T9QA 1VZGA 3NFPI 1VZHA 4AI1A 3RZDL 3RYGA 1CAAA 2AYJA 1I50L 1C09A 2VL6A 2JI3A 2V0FA 8RXNA 1B2JA 2JA6L 2NVXL 1B13A 3KYYA 1FHHA 3HOWL 4A3ML 5RXNA 2CKAA 3RZ6A 3H3VM 2JI1A 5IP7L 4A3JL 1R0JA 1TWFL 2XJSA 5EIOC 3S2DL 1P7PA 2DSXA 6RXNA 3LNLA 1DX8A 2XJUA 3S2HL 7RXNA 3WWNB 3KYWA 4BBRL 1WCML 3GTJL 3GTPL 5DM71 4AI3A 1H7VA 2XJPA 3QQCE 1K83L 1RB9A 2RDVA 4QIWP 3K35A 4LHNA 2C6BA 3RZTA 3GTGL 3J7Y1 3CQZL 5AI2A 2Z3QB 1F4LA 5FLML 3S1NL 3I4NL 2XJVA 2R92L 1E8JA 1BQ9A 2JI2A 1QCVA 2PVEA 5GAHc 1RYTA 3M3YL 3PWFA 3FKIL 2E2HL 3S1ML 2PSMC 1B2OA 3H9BA 2V0EA 4AI0A 3HOUL 4AHZA 1OWCA 1IW7D 2PMZP 3PZAA 1T9OA 4POFA 3H0GL 3H97A 4A3GL 1ZRPA 3H9CA 4GS7D 4BY7L 1Z92B 5GAEc 4A93L 4AR6A 2ERJA 1IU6A 4AHWA 2LCQA 1R0HA 3VPBE 2M4VA 3KYVA 3LWPB 4A3KL 3PO2L 3LWVB 1PFYA 3PO3L 3PKJA 1BRFA 1IROA 1PFWA 3B0AB 3S1RL 1QYBA 1SMUA 1YV1A 2AUSB 1TWAL 5K2ME 1TWCL 2HR5A 3K7AL 3SS2A 5MLC3 1SMWA 1R0IA 3ZG6A 4ZN1B 2E2IL
chains in the Genus database with same CATH topology
1LKMA 4AI3A 1IU5A 1H7VA 2XJPA 3QQCE 4TVMA 3MSUA 3IU3I 1T9PA 1BE7A 2MS3A 1RB9A 1RDGA 1S2ZA 2RDVA 4B8CD 3K35A 5DM61 4E6YA 2CKCA 4LHNA 1IRNA 5MFPA 1S24A 2C6BA 1BQ8A 5AI3A 3RZTA 5AN9H 5MF6A 2L0ZA 3J7Y1 2M4YA 2XJQA 1BFYA 3LPEB 2A69D 1NXGA 2Z3QB 5AI2A 5GADc 3J7Z1 5H1Sc 1R0FA 1YK5A 2CR8A 2KKDA 2XJVA 4RXNA 1E8JA 1FHMA 1BQ9A 3QVDA 1YUXA 2A6ED 2C6AA 2JI2A 5MFZA 3PIO1 2V3BB 1QCVA 1ODHA 2PVEA 1SMMA 5JVG1 4JAFA 4XGHA 1LTLA 5GAHc 1RYTA 3WWLA 3PWFA 2KN9A 4AHYA 2XJTA 2PSMC 1B2OA 2QL0A 2ZIXA 2V0EA 3KYXA 1B71A 1LKPA 3P2AA 2J9UB 4AI0A 3PIP1 4ZN3B 1YUZA 2B5ID 5DM71 4LHLA 5JVH1 2ERSA 2O5JD 4AHZA 4AR4A 1OWCA 5EINC 4YWLA 2PVXA 1NNQA 4TPUA 1IW7D 2BE5D 3PZAA 4V196 1T9QA 1T9OA 5MGNA 1VZGA 4POFA 3NFPI 4POGA 1DVBA 1VZHA 4AI1A 3RYGA 1CAAA 2AYJA 1R0GA 1CADA 1C09A 4K9FA 4YWMA 1ZRPA 4GS7D 4AR3A 4JAEA 1Z92B 2VL6A 3B08B 4G6BA 2JI3A 2V0FA 8RXNA 5GAEc 1B2JA 1NXEA 4AR6A 2ERJA 4JAGA 1IU6A 1RYQA 1VZIA 2K2DA 1B13A 2Z3RB 3KYYA 2LCQA 1RWDA 4AHXA 4AHWA 1FHHA 1R0HA 3VPBE 5RXNA 2M4VA 1LKOA 1YK4A 2CKAA 2PYAA 3RZ6A 3KYVA 4U671 4ME3A 2JI1A 5GAGc 3P8BA 3PKIA 1R0JA 1BRFA 1IROA 1VCXA 3PKJA 2H12A 2XJRA 2XJSA 5EIOC 2PPTA 3B0AB 1QYBA 2DSXA 1SMUA 6RXNA 3LNLA 5IY0A 2M6OA 1DX8A 1YV1A 2XJUA 2A68D 5K2ME 3A44A 2GMGA 2HR5A 4AI2A 2NYDA 7RXNA 3WWNB 4UY81 3KYWA 3SS2A 4XXBB 5MLC3 4AR5A 1WJVA 1SMWA 1JYBA 3KYUA 1OWBA 4WFN1 2M6PA 1R0IA 3MPSA 1RDVA 3ZG6A 2A6HD 4ZN1B 4JADA 1S30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKM A;  1IU5 A;  1H7V A;  1T9P A;  1BE7 A;  2MS3 A;  1RB9 A;  1RDG A;  1S2Z A;  2RDV A;  1IRN A;  1S24 A;  1BQ8 A;  5AI3 A;  3RZT A;  2M4Y A;  1BFY A;  5AI2 A;  1R0F A;  1YK5 A;  4RXN A;  2KKD A;  1E8J A;  1FHM A;  1BQ9 A;  3QVD A;  1YUX A;  2V3B B;  1QCV A;  2PVE A;  1SMM A;  1LTL A;  1RYT A;  3PWF A;  2KN9 A;  1B2O A;  2QL0 A;  3KYX A;  1B71 A;  1LKP A;  1YUZ A;  4AR4 A;  4YWL A;  4TPU A;  1NNQ A;  2PVX A;  3PZA A;  1T9Q A;  1T9O A;  4POF A;  4POG A;  1DVB A;  3RYG A;  1CAA A;  1R0G A;  1CAD A;  1C09 A;  4K9F A;  4YWM A;  1ZRP A;  4AR3 A;  2VL6 A;  8RXN A;  1B2J A;  4AR6 A;  1IU6 A;  2K2D A;  1B13 A;  3KYY A;  2LCQ A;  1RWD A;  1FHH A;  1R0H A;  5RXN A;  1LKO A;  1YK4 A;  2PYA A;  3RZ6 A;  3KYV A;  4ME3 A;  1R0J A;  1BRF A;  1IRO A;  1VCX A;  1QYB A;  2DSX A;  1SMU A;  6RXN A;  5IY0 A;  1DX8 A;  1YV1 A;  3A44 A;  2GMG A;  2HR5 A;  7RXN A;  3KYW A;  3SS2 A;  4AR5 A;  1SMW A;  1JYB A;  3KYU A;  1R0I A;  3MPS A;  1RDV A;  1S30 A; 
#chains in the Genus database with same CATH topology
 1LKM A;  1BE7 A;  2MS3 A;  3HKZ P;  1S2Z A;  4A3E L;  2R93 L;  5MFP A;  1S24 A;  4BY1 L;  3MQK B;  2M4Y A;  2XJQ A;  1NXG A;  5GAD c;  3J7Z 1;  4AYB P;  4RXN A;  2C6A A;  2V3B B;  2EY4 E;  5JVG 1;  2KN9 A;  4A3I L;  3KYX A;  3HOV L;  1LKP A;  3P2A A;  1PZX A;  3HAX C;  2B5I D;  5JVH 1;  2ERS A;  4A3L L;  2WAQ P;  5MGN A;  4POG A;  1R0G A;  3RZO L;  4K9F A;  4JAE A;  4G6B A;  1NXE A;  5C44 L;  2K2D A;  2Z3R B;  4AHX A;  1RWD A;  5IYC L;  1Y1W L;  4A3D L;  2PYA A;  3H99 A;  5GAG c;  3PKI A;  2H12 A;  2XJR A;  2PPT A;  4C2M 1;  5C4J L;  1SFO L;  2APO B;  2A68 D;  3A44 A;  5M5W L;  2GMG A;  4AI2 A;  2NYD A;  4C3J L;  2WB1 P;  3S14 L;  4XXB B;  3KYU A;  1OWB A;  4WFN 1;  3MPS A;  1RDV A;  4JAG A;  4JAD A;  3P8B A;  5C4X L;  3MSU A;  1T9P A;  4V19 6;  4B8C D;  5DM6 1;  4E6Y A;  1IRN A;  5AI3 A;  1TWH L;  3HOZ L;  1BFY A;  2A69 D;  3S1Q L;  5H1S c;  1YK5 A;  1FHM A;  3QVD A;  1YUX A;  3HJY B;  1PFV A;  4A3F L;  4BBS L;  1ODH A;  3LWO B;  1SMM A;  4XGH A;  3GTQ L;  3GTK L;  3WWL A;  2XJT A;  2ZIX A;  5M3F L;  3M4O L;  4BXX L;  4ZN3 B;  2VUM L;  4A3C L;  5IYB L;  1I3Q L;  5EIN C;  4TPU A;  3HOY L;  1DVB A;  5IYD L;  4C3I L;  1CAD A;  4YWM A;  4AR3 A;  2NVY L;  5M5Y L;  3B08 B;  2RFK B;  5IP9 L;  1RYQ A;  2HVY C;  1VZI A;  2Y0S P;  2AQC A;  3HOX L;  1I6H L;  3HJW B;  1LKO A;  1YK4 A;  5FJ8 L;  4U67 1;  4ME3 A;  4Y52 L;  2E2J L;  3GTL L;  1VCX A;  5M3M L;  5C3E L;  4X6A L;  5IY0 A;  2M6O A;  5M5X L;  4UY8 1;  3S15 L;  2R7Z L;  2NVQ L;  1TWG L;  3PL5 A;  4AR5 A;  3I4M L;  1WJV A;  1JYB A;  2M6P A;  2JA8 L;  2A6H D;  1S30 A;  4A3B L;  1IU5 A;  4TVM A;  3JR7 A;  3IU3 I;  3LWQ B;  1RDG A;  2NVT L;  2CKC A;  1BQ8 A;  5AN9 H;  3GTM L;  5MF6 A;  2L0Z A;  4C3H L;  1R9T L;  3LPE B;  3LWR B;  1R0F A;  3S17 L;  2CR8 A;  2KKD A;  2A6E D;  2YU9 L;  5MFZ A;  3PIO 1;  4Y7N L;  4JAF A;  3S16 L;  1LTL A;  3GTO L;  2JA5 L;  4AHY A;  2QL0 A;  1B71 A;  2J9U B;  1Y1V L;  3PIP 1;  1YUZ A;  2JA7 L;  4LHL A;  3FDJ A;  1QQT A;  2O5J D;  4AR4 A;  2B63 L;  4YWL A;  1PFU A;  1NNQ A;  2PVX A;  2BE5 D;  1T9Q A;  1VZG A;  3NFP I;  1VZH A;  4AI1 A;  3RZD L;  3RYG A;  1CAA A;  2AYJ A;  1I50 L;  1C09 A;  2VL6 A;  2JI3 A;  2V0F A;  8RXN A;  1B2J A;  2JA6 L;  2NVX L;  1B13 A;  3KYY A;  1FHH A;  3HOW L;  4A3M L;  5RXN A;  2CKA A;  3RZ6 A;  3H3V M;  2JI1 A;  5IP7 L;  4A3J L;  1R0J A;  1TWF L;  2XJS A;  5EIO C;  3S2D L;  1P7P A;  2DSX A;  6RXN A;  3LNL A;  1DX8 A;  2XJU A;  3S2H L;  7RXN A;  3WWN B;  3KYW A;  4BBR L;  1WCM L;  3GTJ L;  3GTP L;  5DM7 1;  4AI3 A;  1H7V A;  2XJP A;  3QQC E;  1K83 L;  1RB9 A;  2RDV A;  4QIW P;  3K35 A;  4LHN A;  2C6B A;  3RZT A;  3GTG L;  3J7Y 1;  3CQZ L;  5AI2 A;  2Z3Q B;  1F4L A;  5FLM L;  3S1N L;  3I4N L;  2XJV A;  2R92 L;  1E8J A;  1BQ9 A;  2JI2 A;  1QCV A;  2PVE A;  5GAH c;  1RYT A;  3M3Y L;  3PWF A;  3FKI L;  2E2H L;  3S1M L;  2PSM C;  1B2O A;  3H9B A;  2V0E A;  4AI0 A;  3HOU L;  4AHZ A;  1OWC A;  1IW7 D;  2PMZ P;  3PZA A;  1T9O A;  4POF A;  3H0G L;  3H97 A;  4A3G L;  1ZRP A;  3H9C A;  4GS7 D;  4BY7 L;  1Z92 B;  5GAE c;  4A93 L;  4AR6 A;  2ERJ A;  1IU6 A;  4AHW A;  2LCQ A;  1R0H A;  3VPB E;  2M4V A;  3KYV A;  3LWP B;  4A3K L;  3PO2 L;  3LWV B;  1PFY A;  3PO3 L;  3PKJ A;  1BRF A;  1IRO A;  1PFW A;  3B0A B;  3S1R L;  1QYB A;  1SMU A;  1YV1 A;  2AUS B;  1TWA L;  5K2M E;  1TWC L;  2HR5 A;  3K7A L;  3SS2 A;  5MLC 3;  1SMW A;  1R0I A;  3ZG6 A;  4ZN1 B;  2E2I L; 
#chains in the Genus database with same CATH homology
 1LKM A;  4AI3 A;  1IU5 A;  1H7V A;  2XJP A;  3QQC E;  4TVM A;  3MSU A;  3IU3 I;  1T9P A;  1BE7 A;  2MS3 A;  1RB9 A;  1RDG A;  1S2Z A;  2RDV A;  4B8C D;  3K35 A;  5DM6 1;  4E6Y A;  2CKC A;  4LHN A;  1IRN A;  5MFP A;  1S24 A;  2C6B A;  1BQ8 A;  5AI3 A;  3RZT A;  5AN9 H;  5MF6 A;  2L0Z A;  3J7Y 1;  2M4Y A;  2XJQ A;  1BFY A;  3LPE B;  2A69 D;  1NXG A;  2Z3Q B;  5AI2 A;  5GAD c;  3J7Z 1;  5H1S c;  1R0F A;  1YK5 A;  2CR8 A;  2KKD A;  2XJV A;  4RXN A;  1E8J A;  1FHM A;  1BQ9 A;  3QVD A;  1YUX A;  2A6E D;  2C6A A;  2JI2 A;  5MFZ A;  3PIO 1;  2V3B B;  1QCV A;  1ODH A;  2PVE A;  1SMM A;  5JVG 1;  4JAF A;  4XGH A;  1LTL A;  5GAH c;  1RYT A;  3WWL A;  3PWF A;  2KN9 A;  4AHY A;  2XJT A;  2PSM C;  1B2O A;  2QL0 A;  2ZIX A;  2V0E A;  3KYX A;  1B71 A;  1LKP A;  3P2A A;  2J9U B;  4AI0 A;  3PIP 1;  4ZN3 B;  1YUZ A;  2B5I D;  5DM7 1;  4LHL A;  5JVH 1;  2ERS A;  2O5J D;  4AHZ A;  4AR4 A;  1OWC A;  5EIN C;  4YWL A;  2PVX A;  1NNQ A;  4TPU A;  1IW7 D;  2BE5 D;  3PZA A;  4V19 6;  1T9Q A;  1T9O A;  5MGN A;  1VZG A;  4POF A;  3NFP I;  4POG A;  1DVB A;  1VZH A;  4AI1 A;  3RYG A;  1CAA A;  2AYJ A;  1R0G A;  1CAD A;  1C09 A;  4K9F A;  4YWM A;  1ZRP A;  4GS7 D;  4AR3 A;  4JAE A;  1Z92 B;  2VL6 A;  3B08 B;  4G6B A;  2JI3 A;  2V0F A;  8RXN A;  5GAE c;  1B2J A;  1NXE A;  4AR6 A;  2ERJ A;  4JAG A;  1IU6 A;  1RYQ A;  1VZI A;  2K2D A;  1B13 A;  2Z3R B;  3KYY A;  2LCQ A;  1RWD A;  4AHX A;  4AHW A;  1FHH A;  1R0H A;  3VPB E;  5RXN A;  2M4V A;  1LKO A;  1YK4 A;  2CKA A;  2PYA A;  3RZ6 A;  3KYV A;  4U67 1;  4ME3 A;  2JI1 A;  5GAG c;  3P8B A;  3PKI A;  1R0J A;  1BRF A;  1IRO A;  1VCX A;  3PKJ A;  2H12 A;  2XJR A;  2XJS A;  5EIO C;  2PPT A;  3B0A B;  1QYB A;  2DSX A;  1SMU A;  6RXN A;  3LNL A;  5IY0 A;  2M6O A;  1DX8 A;  1YV1 A;  2XJU A;  2A68 D;  5K2M E;  3A44 A;  2GMG A;  2HR5 A;  4AI2 A;  2NYD A;  7RXN A;  3WWN B;  4UY8 1;  3KYW A;  3SS2 A;  4XXB B;  5MLC 3;  4AR5 A;  1WJV A;  1SMW A;  1JYB A;  3KYU A;  1OWB A;  4WFN 1;  2M6P A;  1R0I A;  3MPS A;  1RDV A;  3ZG6 A;  2A6H D;  4ZN1 B;  4JAD A;  1S30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...