6AUNA

Calcium-independent phospholipase a2 beta
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
672
structure length
618
Chain Sequence
LVNFQQFSSQLPPFVEVLQHLSDPSWTVTHLAVESTENEEGCTPLHLACRKGDSEILVELVQYCHAQMDVTDNKGETAFHYAVQGDNSQVLQLLGKNASAGLNQVNKQGLTPLHLACQMGKQEMVRVLLLCNARCNVMGPSGFPIHTAMKFSQKGCAEMIISMDSSQIHSKDPRYGASPLHWAKNAEMARMLLKRGCDVDSTSAAGNTALHVAVMRNRFDCVMVLLTYGANAGTPGEHGNTPLHLAISKDNMEMIKALIVFGAEVDTPNDFGETPAFMASKISKQLQDLMPISPAFILSSMRDEKRIHDHLLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGVYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLSDRQPAELHLFRNYDAPEVIREPRFNQNINLKPPTQPADQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDMIRKGQGNKVKKLSIVVSLGTGRSPQVPVTCKELGKMVVDCCTDPDGRAVDRARAWSEMVGIQYFRLNPQLGSDIMLDEVNDAVLVNALWETEVYIYEHREEFQKLVQMLLSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PLA2G6, iPLA2beta
publication title The structure of iPLA2beta reveals dimeric active sites and suggests mechanisms of regulation and localization.
pubmed doi rcsb
source organism Cricetulus griseus
total genus 143
structure length 618
sequence length 672
chains with identical sequence B
ec nomenclature ec 3.1.1.4: Phospholipase A(2).
pdb deposition date 2017-09-01
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...