6AZ3Z

Cryo-em structure of of the large subunit of leishmania ribosome bound to paromomycin
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
140
structure length
140
Chain Sequence
SHSVDLQWILVRQNSRFLQKRGGIRMSNDPFNNNGNWTKRHCGFLNEKAAVVKPAKGGAICVTVKDGSSNNKPRQTYRKTVHAAGVRASDVSRAVAAVRPDLADVSFRRARRMACIASRTAKVAAARKARSEKIKFSRKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords ribosomal protein uL2
publication title Atomic resolution snapshot of Leishmania ribosome inhibition by the aminoglycoside paromomycin.
pubmed doi rcsb
total genus 34
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2017-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01778 Ribosomal_L28e Ribosomal L28e protein family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...