6AZDA

Crystal structure of physcomitrella patens kai2-like h
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
266
structure length
266
Chain Sequence
SPLLSTHNVTVLGNRSDPVVVLGHGLGTDQSVWKYTVPSLVNQNFQVVLYDTMGAGSTETSDFNFKRYSSLQGHVDDLLAILDELEIENCVYVGHSMSGMIGVLASLERPDLFRKLILLSASPRYLNDSSYYGGFEQEDLDQLFSSMRSNFSAWVSGFATAAVGTDIHDEAVQEFSSTFISMRPDVALRTSQFVFQSDFRSILSEVTVPCHIVQSRKDIAVPIEVAEYLRCNLGGWTSVDILQTDGHLPQLSCPELVVPVLLHCID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Karrikin and Non-natural Strigolactone Perception in Physcomitrella patens.
pubmed doi rcsb
source organism Physcomitrella patens subsp. patens
molecule tags Hydrolase
molecule keywords PpKAI2-like H
total genus 96
structure length 266
sequence length 266
ec nomenclature ec 3.-.-.-:
pdb deposition date 2017-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...