6CFJ16

Crystal structure of the thermus thermophilus 70s ribosome in complex with histidyl-cam and bound to mrna and a-, p-, and e-site trnas at 2.8a resolution
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
53
structure length
53
Chain Sequence
ASEVRIKLLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREVKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/inhibitor
molecule keywords 23S Ribosomal RNA
publication title Binding and Action of Amino Acid Analogs of Chloramphenicol upon the Bacterial Ribosome.
pubmed doi rcsb
source organism Escherichia coli
total genus 6
structure length 53
sequence length 53
chains with identical sequence 26
ec nomenclature
pdb deposition date 2018-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
16 PF00471 Ribosomal_L33 Ribosomal protein L33
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...