6CIAA

Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with nadph.
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
284
structure length
284
Chain Sequence
MVKKTVRFGEQAAVPAIGLGTWYMGEHAAQRQQEVAALRAGIDHGLTVIDTAEMYADGGAEEVVGQAIRGLRDRVVLVSKVYPWHAGKAAMHRACENSLRRLQTDYLDMYLLHWRGDIPLQETVEAMEKLVAEGKIRRWGVSNLDTEDMQALWRTADGEHCATNQVLYHLASRGIEYDLLPWCQQHSLPVMAYCPLAQAGRLRDGLFQHSDIINMANARGITVAQLLLAWVIRHPGVLAIPKAASIEHVVQNAAALDIVLSGEELAQLDRLYPPPQRKTRLDMV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aldo/keto reductase
publication title Crystal structure of of aldo-keto reductase from Klebsiella pneumoniae in complex with NADPH.
rcsb
source organism Klebsiella pneumoniae
total genus 95
structure length 284
sequence length 284
ec nomenclature ec 1.1.1.-:
pdb deposition date 2018-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...