6CK7A

Crystal structure of a peptide deformylase from legionella pneumophila bound to actinonin
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
172
structure length
172
Chain Sequence
HHMAIRKILYLPDERLRKIAKPVETFDESLQTLINDMFDTMYDARGVGLAAPQIGVSLRLSVIDIVGDKKEQIVIVNPEIVSSHGEKEFEEGCLSVPGAYDTVVRAEKVTVKALDRFGKPFEITGEGLLAECLQHEIDHMNGKLFVDMLSPLKRMMARRKLDKFKRLQARKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/antibiotic
molecule keywords Peptide deformylase
publication title Crystal structure of a peptide deformylase from Legionella pneumophila bound to actinonin
rcsb
source organism Legionella pneumophila
total genus 54
structure length 172
sequence length 172
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.88: Peptide deformylase.
pdb deposition date 2018-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01327 Pep_deformylase Polypeptide deformylase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...