6DCDA

Mycobacterium marinum cytochrome p450 cyp150a6 in the substrate-free form
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
422
structure length
406
Chain Sequence
SYESIDFFTDPSLIPDPHPYFDYLRSQSPVLRLPQYGVVAVTGYEEATAVYKDTDSFSNCVALGGPFPPLPFAPNGDDVNAQIDAHREQFPMYEHMVTMDPPEHSRARSILSRLLTPSRLKQNEEFMWRLADRQLDEFLGAGECEFISEYAKPFATLVIADLLGVPEDDRKDFRVVLGVNPLQWLDDKFSAYIEDRRRQPRNDVLTALATATYPDGSTPEVIDVVRSATFLFAAGQETTAKLLTAAMRVLGDRPDIQRRLRENRSLIPNFIEESLRMDSPVKSDSRLARKRTTVGGLDIAAGTVVMVLPGAANRDPRRFEDPHEFRLDRPNVREHMAFARGVHSCPGGPLARVEGRVSLERILDRMLDIAINEDRHGPADDRRYTYEPTYILRGLTELHITFTPAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome P450 150A6 Cyp150A6
publication title The characterisation of two members of the cytochrome P450 CYP150 family: CYP150A5 and CYP150A6 from Mycobacterium marinum.
pubmed doi rcsb
source organism Mycobacterium marinum
total genus 151
structure length 406
sequence length 422
ec nomenclature
pdb deposition date 2018-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00067 p450 Cytochrome P450
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...