6DUQM

Structure of a rho-nusg kow domain complex
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
49
structure length
43
Chain Sequence
MVRVNDGPFADFNGVVEERLKVSVSIFGRATPVELDFSQVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/rna
molecule keywords Transcription termination factor Rho
publication title Mechanism for the Regulated Control of Bacterial Transcription Termination by a Universal Adaptor Protein.
pubmed doi rcsb
source organism Escherichia coli m718
total genus 3
structure length 43
sequence length 49
chains with identical sequence N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2018-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00467 KOW KOW motif
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...