6DVUA

Structure of the monoclinic-1 (monocl-1) crystal form of human apolipoprotein c1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
51
structure length
51
Chain Sequence
SSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKEKLKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lipid transport
molecule keywords Apolipoprotein C-I
publication title The structure of human apolipoprotein C-1 in four different crystal forms.
pubmed doi rcsb
total genus 22
structure length 51
sequence length 51
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04691 ApoC-I Apolipoprotein C-I (ApoC-1)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...