6DZDA

Crystal structure of bacillus licheniformis hypothetical protein yfih
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
276
structure length
269
Chain Sequence
NTYNPFRLDAPSMLLIEEWNQVTAGFTTKNGGESEPPFHSLNTGLHVQDHEQHVINNRKKVADILKTDLHDWVFADQTHEDRIHKVTDGDRASGAFRYDTALKATDGLYTDRPNLFLALCFADCVPVYFYDPVRSLVGIAHAGWKGTALGIAASMVDMWIRREGSNPADIRAVIGPAIGSCCYTVDDHVIDKIRNLPLQQEDKAFLTIKEGEYRLELKEVNRQLLVHAGIPNGQIEVSSLCTSCERSLFFSHRRDRGKTGRMMSFIGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords hypothetical protein YfiH
publication title Crystal structure of Bacillus licheniformis hypothetical protein YfiH
rcsb
source organism Bacillus licheniformis
total genus 88
structure length 269
sequence length 276
chains with identical sequence B
ec nomenclature
pdb deposition date 2018-07-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...