6E7DQ

Structure of the inhibitory nkr-p1b receptor bound to the host-encoded ligand, clr-b
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
117
Chain Sequence
KLECPQDWLSHRDKCFHVSQVSNTWKEGRIDCDKKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLSYTNWKWINGTAFNSDITGVTENGSCAAISGEKVTSEGCSSDNRWICQKEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-type lectin domain family 2 member D
publication title Recognition of host Clr-b by the inhibitory NKR-P1B receptor provides a basis for missing-self recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 27
structure length 117
sequence length 124
chains with identical sequence R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2018-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00059 Lectin_C Lectin C-type domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...