6EBXA

Structure determination of a dimeric form of erabutoxin b, crystallized from thiocyanate solution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination of a dimeric form of erabutoxin-b, crystallized from a thiocyanate solution.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
molecule keywords ERABUTOXIN B
total genus 11
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 6ebxA00
2FD6U 4FAOE 2K3GA 1JE9A 2H62C 1YWHA 2CTXA 1HOYA 1IK8A 2X8BB 1KU6B 2H64C 2MFAA 4BDTB 3NH7A 2JQPA 4QTIU 2MHYA 2MJYA 1JGKA 1ES7B 1CDQA 2MJ4A 1KC4A 1FSCA 1IQ9A 4UY2C 4OM4A 1IKCA 1HAJA 1KBTA 2QJAC 1NYSA 1L4WA 2L03A 4BIKB 3BT1U 1FFJA 1KS6A 1CODA 1NXBA 2QJ9C 4XJJA 2H7ZB 2QJBC 4P7UA 3HH7A 2GOOB 1CXNA 4HQPF 1TGXA 2HLRA 1HC9A 3U73U 5IMYC 1RGJA 2MUPA 2OFSA 1ERGA 4OM5A 1HC9B 1NORA 1CXOA 1S4YA 1MAHF 1V6PA 2MJ0A 2H5FA 1NEAA 1HAAA 2MUOA 5EBXA 1CREA 5DO6A 4ZQYA 4FAOC 3PLCA 2UX2A 5DU1A 4DO8A 1IDLA 1DRSA 1CRFA 1UG4A 1KBAA 1H0JA 1IDHA 2LCRA 2J8BA 1CDRA 2GOOC 4EY8B 2I9BE 3VTSA 1MR6A 1NTNA 2BTXA 3FEVA 1QKDA 1ERAA 1FSSB 2ABXA 1CDSA 2BHIA 1RL5A 2H64B 1KBSA 1LX5B 6EBXA 2UWRA 1CTXA 1KXIA 1QM7A 1KL8A 5IMTD 2N99A 2CRSA 1TFSA 1BXPA 2H8UA 1XT3A 3EBXA 3QB4B 3U74U 1ONJA 1CCQA 1FRAA 3EVSC 1CVOA 1COEA 3ERAA 4LFTA 1BTEA 1TXBA 1LXGA 1QKEA 1CB9A 2H62D 2H7ZA 1LSIA 2PJYC 1M9ZA 2JVEA 1FASA 3NEQA 4IYEA 1F94A 1LXHA 2CCXA 1IDIA 1G6MA 3LAQU 4RUDA 2CRTA 1CHVS 1TXAA 1ABTA 1IJCA 1NYUA 2QC1A 2VLWA 2HLQA 3BT2U 1LJZA 1B41B 1CDTA 3KFDE 1JBDA 2LA1A 2ERAA 1FF4A 1PLOA 1I02A 1ZADA 1VB0A 5DZ5A 1W6BA 1KTZB 1REWC 3NDSA 1F8UB 1IDGA 2L5SA 2NBTA 1KFHA 4AEAA 3KFDI 1NTXA 2PJYB 2CDXA
chains in the Genus database with same CATH superfamily
2FD6U 4FAOE 2K3GA 1JE9A 2H62C 1YWHA 2CTXA 1HOYA 1IK8A 2X8BB 1KU6B 2H64C 2MFAA 4BDTB 3NH7A 2JQPA 4QTIU 2MHYA 2MJYA 1JGKA 1ES7B 1CDQA 2MJ4A 1KC4A 1FSCA 1IQ9A 4UY2C 4OM4A 1IKCA 1HAJA 1KBTA 2QJAC 1NYSA 1L4WA 2L03A 4BIKB 3BT1U 1FFJA 1KS6A 1CODA 1NXBA 2QJ9C 4XJJA 2H7ZB 2QJBC 4P7UA 3HH7A 2GOOB 1CXNA 4HQPF 1TGXA 2HLRA 1HC9A 3U73U 5IMYC 1RGJA 2MUPA 2OFSA 1ERGA 4OM5A 1HC9B 1NORA 1CXOA 1S4YA 1MAHF 1V6PA 2MJ0A 2H5FA 1NEAA 1HAAA 2MUOA 5EBXA 1CREA 5DO6A 4ZQYA 4FAOC 3PLCA 2UX2A 5DU1A 4DO8A 1IDLA 1DRSA 1CRFA 1UG4A 1KBAA 1H0JA 1IDHA 2LCRA 2J8BA 1CDRA 2GOOC 4EY8B 2I9BE 4KSNA 3VTSA 1MR6A 1NTNA 2BTXA 3FEVA 1QKDA 1ERAA 1FSSB 2ABXA 1CDSA 2BHIA 1RL5A 2H64B 1KBSA 1LX5B 6EBXA 2UWRA 1CTXA 1KXIA 1QM7A 1KL8A 5IMTD 2N99A 2CRSA 1TFSA 1BXPA 2H8UA 1XT3A 3EBXA 3QB4B 3U74U 1ONJA 1CCQA 1FRAA 3EVSC 1CVOA 1COEA 3ERAA 4LFTA 1BTEA 1TXBA 1LXGA 1QKEA 1CB9A 2H62D 2H7ZA 1LSIA 2PJYC 1M9ZA 2JVEA 1FASA 3NEQA 4IYEA 1F94A 1LXHA 2CCXA 1IDIA 1G6MA 3LAQU 4RUDA 2CRTA 1CHVS 1TXAA 1ABTA 1IJCA 1NYUA 2QC1A 2VLWA 2HLQA 3BT2U 1LJZA 1B41B 1CDTA 3KFDE 1JBDA 2LA1A 2ERAA 1FF4A 1PLOA 1I02A 1ZADA 1VB0A 5DZ5A 1W6BA 1KTZB 1REWC 3NDSA 1F8UB 1IDGA 2L5SA 2NBTA 1KFHA 4AEAA 3KFDI 1NTXA 2PJYB 2CDXA
chains in the Genus database with same CATH topology
2FD6U 4FAOE 2K3GA 1JE9A 2H62C 1YWHA 2CTXA 1HOYA 1IK8A 2X8BB 1KU6B 2H64C 2MFAA 4BDTB 3NH7A 2JQPA 4QTIU 2MHYA 2MJYA 1JGKA 1ES7B 1CDQA 2MJ4A 1KC4A 1FSCA 1IQ9A 4UY2C 4OM4A 1IKCA 1HAJA 1KBTA 2QJAC 1NYSA 1L4WA 2L03A 4BIKB 3BT1U 1FFJA 1KS6A 1CODA 1NXBA 2QJ9C 4XJJA 2H7ZB 2QJBC 4P7UA 3HH7A 2GOOB 1CXNA 4HQPF 1TGXA 2HLRA 1HC9A 3U73U 5IMYC 1RGJA 2MUPA 2OFSA 1ERGA 4OM5A 1HC9B 1NORA 1CXOA 1S4YA 1MAHF 1V6PA 2MJ0A 2H5FA 1NEAA 1HAAA 2MUOA 5EBXA 1CREA 5DO6A 4ZQYA 4FAOC 3PLCA 2UX2A 5DU1A 4DO8A 1IDLA 1DRSA 1CRFA 1UG4A 1KBAA 1H0JA 1IDHA 2LCRA 2J8BA 1CDRA 2GOOC 4EY8B 2I9BE 4KSNA 3VTSA 1MR6A 1NTNA 2BTXA 3FEVA 1QKDA 1ERAA 1FSSB 2ABXA 1CDSA 2BHIA 1RL5A 2H64B 1KBSA 1LX5B 6EBXA 2UWRA 1CTXA 1KXIA 1QM7A 1KL8A 5IMTD 2N99A 2CRSA 1TFSA 1BXPA 2H8UA 1XT3A 3EBXA 3QB4B 3U74U 1ONJA 1CCQA 1FRAA 3EVSC 1CVOA 1COEA 3ERAA 4LFTA 1BTEA 1TXBA 1LXGA 1QKEA 1CB9A 2H62D 2H7ZA 1LSIA 2PJYC 1M9ZA 2JVEA 1FASA 3NEQA 4IYEA 1F94A 1LXHA 2CCXA 1IDIA 1G6MA 3LAQU 4RUDA 2CRTA 1CHVS 1TXAA 1ABTA 1IJCA 1NYUA 2QC1A 2VLWA 2HLQA 3BT2U 1LJZA 1B41B 1CDTA 3KFDE 1JBDA 2LA1A 2ERAA 1FF4A 1PLOA 1I02A 1ZADA 1VB0A 5DZ5A 1W6BA 1KTZB 1REWC 3NDSA 1F8UB 1IDGA 2L5SA 2NBTA 1KFHA 4AEAA 3KFDI 1NTXA 2PJYB 2CDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FD6 U;  4FAO E;  2K3G A;  1JE9 A;  2H62 C;  1YWH A;  2CTX A;  1HOY A;  1IK8 A;  2X8B B;  1KU6 B;  2H64 C;  2MFA A;  4BDT B;  3NH7 A;  2JQP A;  4QTI U;  2MHY A;  2MJY A;  1JGK A;  1ES7 B;  1CDQ A;  2MJ4 A;  1KC4 A;  1FSC A;  1IQ9 A;  4UY2 C;  4OM4 A;  1IKC A;  1HAJ A;  1KBT A;  2QJA C;  1NYS A;  1L4W A;  2L03 A;  4BIK B;  3BT1 U;  1FFJ A;  1KS6 A;  1COD A;  1NXB A;  2QJ9 C;  4XJJ A;  2H7Z B;  2QJB C;  4P7U A;  3HH7 A;  2GOO B;  1CXN A;  4HQP F;  1TGX A;  2HLR A;  1HC9 A;  3U73 U;  5IMY C;  1RGJ A;  2MUP A;  2OFS A;  1ERG A;  4OM5 A;  1HC9 B;  1NOR A;  1CXO A;  1S4Y A;  1MAH F;  1V6P A;  2MJ0 A;  2H5F A;  1NEA A;  1HAA A;  2MUO A;  5EBX A;  1CRE A;  5DO6 A;  4ZQY A;  4FAO C;  3PLC A;  2UX2 A;  5DU1 A;  4DO8 A;  1IDL A;  1DRS A;  1CRF A;  1UG4 A;  1KBA A;  1H0J A;  1IDH A;  2LCR A;  2J8B A;  1CDR A;  2GOO C;  4EY8 B;  2I9B E;  3VTS A;  1MR6 A;  1NTN A;  2BTX A;  3FEV A;  1QKD A;  1ERA A;  1FSS B;  2ABX A;  1CDS A;  2BHI A;  1RL5 A;  2H64 B;  1KBS A;  1LX5 B;  6EBX A;  2UWR A;  1CTX A;  1KXI A;  1QM7 A;  1KL8 A;  5IMT D;  2N99 A;  2CRS A;  1TFS A;  1BXP A;  2H8U A;  1XT3 A;  3EBX A;  3QB4 B;  3U74 U;  1ONJ A;  1CCQ A;  1FRA A;  3EVS C;  1CVO A;  1COE A;  3ERA A;  4LFT A;  1BTE A;  1TXB A;  1LXG A;  1QKE A;  1CB9 A;  2H62 D;  2H7Z A;  1LSI A;  2PJY C;  1M9Z A;  2JVE A;  1FAS A;  3NEQ A;  4IYE A;  1F94 A;  1LXH A;  2CCX A;  1IDI A;  1G6M A;  3LAQ U;  4RUD A;  2CRT A;  1CHV S;  1TXA A;  1ABT A;  1IJC A;  1NYU A;  2QC1 A;  2VLW A;  2HLQ A;  3BT2 U;  1LJZ A;  1B41 B;  1CDT A;  3KFD E;  1JBD A;  2LA1 A;  2ERA A;  1FF4 A;  1PLO A;  1I02 A;  1ZAD A;  1VB0 A;  5DZ5 A;  1W6B A;  1KTZ B;  1REW C;  3NDS A;  1F8U B;  1IDG A;  2L5S A;  2NBT A;  1KFH A;  4AEA A;  3KFD I;  1NTX A;  2PJY B;  2CDX A; 
#chains in the Genus database with same CATH topology
 2FD6 U;  4FAO E;  2K3G A;  1JE9 A;  2H62 C;  1YWH A;  2CTX A;  1HOY A;  1IK8 A;  2X8B B;  1KU6 B;  2H64 C;  2MFA A;  4BDT B;  3NH7 A;  2JQP A;  4QTI U;  2MHY A;  2MJY A;  1JGK A;  1ES7 B;  1CDQ A;  2MJ4 A;  1KC4 A;  1FSC A;  1IQ9 A;  4UY2 C;  4OM4 A;  1IKC A;  1HAJ A;  1KBT A;  2QJA C;  1NYS A;  1L4W A;  2L03 A;  4BIK B;  3BT1 U;  1FFJ A;  1KS6 A;  1COD A;  1NXB A;  2QJ9 C;  4XJJ A;  2H7Z B;  2QJB C;  4P7U A;  3HH7 A;  2GOO B;  1CXN A;  4HQP F;  1TGX A;  2HLR A;  1HC9 A;  3U73 U;  5IMY C;  1RGJ A;  2MUP A;  2OFS A;  1ERG A;  4OM5 A;  1HC9 B;  1NOR A;  1CXO A;  1S4Y A;  1MAH F;  1V6P A;  2MJ0 A;  2H5F A;  1NEA A;  1HAA A;  2MUO A;  5EBX A;  1CRE A;  5DO6 A;  4ZQY A;  4FAO C;  3PLC A;  2UX2 A;  5DU1 A;  4DO8 A;  1IDL A;  1DRS A;  1CRF A;  1UG4 A;  1KBA A;  1H0J A;  1IDH A;  2LCR A;  2J8B A;  1CDR A;  2GOO C;  4EY8 B;  2I9B E;  4KSN A;  3VTS A;  1MR6 A;  1NTN A;  2BTX A;  3FEV A;  1QKD A;  1ERA A;  1FSS B;  2ABX A;  1CDS A;  2BHI A;  1RL5 A;  2H64 B;  1KBS A;  1LX5 B;  6EBX A;  2UWR A;  1CTX A;  1KXI A;  1QM7 A;  1KL8 A;  5IMT D;  2N99 A;  2CRS A;  1TFS A;  1BXP A;  2H8U A;  1XT3 A;  3EBX A;  3QB4 B;  3U74 U;  1ONJ A;  1CCQ A;  1FRA A;  3EVS C;  1CVO A;  1COE A;  3ERA A;  4LFT A;  1BTE A;  1TXB A;  1LXG A;  1QKE A;  1CB9 A;  2H62 D;  2H7Z A;  1LSI A;  2PJY C;  1M9Z A;  2JVE A;  1FAS A;  3NEQ A;  4IYE A;  1F94 A;  1LXH A;  2CCX A;  1IDI A;  1G6M A;  3LAQ U;  4RUD A;  2CRT A;  1CHV S;  1TXA A;  1ABT A;  1IJC A;  1NYU A;  2QC1 A;  2VLW A;  2HLQ A;  3BT2 U;  1LJZ A;  1B41 B;  1CDT A;  3KFD E;  1JBD A;  2LA1 A;  2ERA A;  1FF4 A;  1PLO A;  1I02 A;  1ZAD A;  1VB0 A;  5DZ5 A;  1W6B A;  1KTZ B;  1REW C;  3NDS A;  1F8U B;  1IDG A;  2L5S A;  2NBT A;  1KFH A;  4AEA A;  3KFD I;  1NTX A;  2PJY B;  2CDX A; 
#chains in the Genus database with same CATH homology
 2FD6 U;  4FAO E;  2K3G A;  1JE9 A;  2H62 C;  1YWH A;  2CTX A;  1HOY A;  1IK8 A;  2X8B B;  1KU6 B;  2H64 C;  2MFA A;  4BDT B;  3NH7 A;  2JQP A;  4QTI U;  2MHY A;  2MJY A;  1JGK A;  1ES7 B;  1CDQ A;  2MJ4 A;  1KC4 A;  1FSC A;  1IQ9 A;  4UY2 C;  4OM4 A;  1IKC A;  1HAJ A;  1KBT A;  2QJA C;  1NYS A;  1L4W A;  2L03 A;  4BIK B;  3BT1 U;  1FFJ A;  1KS6 A;  1COD A;  1NXB A;  2QJ9 C;  4XJJ A;  2H7Z B;  2QJB C;  4P7U A;  3HH7 A;  2GOO B;  1CXN A;  4HQP F;  1TGX A;  2HLR A;  1HC9 A;  3U73 U;  5IMY C;  1RGJ A;  2MUP A;  2OFS A;  1ERG A;  4OM5 A;  1HC9 B;  1NOR A;  1CXO A;  1S4Y A;  1MAH F;  1V6P A;  2MJ0 A;  2H5F A;  1NEA A;  1HAA A;  2MUO A;  5EBX A;  1CRE A;  5DO6 A;  4ZQY A;  4FAO C;  3PLC A;  2UX2 A;  5DU1 A;  4DO8 A;  1IDL A;  1DRS A;  1CRF A;  1UG4 A;  1KBA A;  1H0J A;  1IDH A;  2LCR A;  2J8B A;  1CDR A;  2GOO C;  4EY8 B;  2I9B E;  4KSN A;  3VTS A;  1MR6 A;  1NTN A;  2BTX A;  3FEV A;  1QKD A;  1ERA A;  1FSS B;  2ABX A;  1CDS A;  2BHI A;  1RL5 A;  2H64 B;  1KBS A;  1LX5 B;  6EBX A;  2UWR A;  1CTX A;  1KXI A;  1QM7 A;  1KL8 A;  5IMT D;  2N99 A;  2CRS A;  1TFS A;  1BXP A;  2H8U A;  1XT3 A;  3EBX A;  3QB4 B;  3U74 U;  1ONJ A;  1CCQ A;  1FRA A;  3EVS C;  1CVO A;  1COE A;  3ERA A;  4LFT A;  1BTE A;  1TXB A;  1LXG A;  1QKE A;  1CB9 A;  2H62 D;  2H7Z A;  1LSI A;  2PJY C;  1M9Z A;  2JVE A;  1FAS A;  3NEQ A;  4IYE A;  1F94 A;  1LXH A;  2CCX A;  1IDI A;  1G6M A;  3LAQ U;  4RUD A;  2CRT A;  1CHV S;  1TXA A;  1ABT A;  1IJC A;  1NYU A;  2QC1 A;  2VLW A;  2HLQ A;  3BT2 U;  1LJZ A;  1B41 B;  1CDT A;  3KFD E;  1JBD A;  2LA1 A;  2ERA A;  1FF4 A;  1PLO A;  1I02 A;  1ZAD A;  1VB0 A;  5DZ5 A;  1W6B A;  1KTZ B;  1REW C;  3NDS A;  1F8U B;  1IDG A;  2L5S A;  2NBT A;  1KFH A;  4AEA A;  3KFD I;  1NTX A;  2PJY B;  2CDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...