6EE5A

Reactive centre loop dynamics and serpin specificity
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
Knots found
sequence length
367
structure length
352
Chain Sequence
QGAASSHKLAEANTDFAFSLYRELAKSSPDKNIFFSPVSISSALAMLSLGAKGDTHTQILEGLGFNSEADIHQGFQHLLQTLNRPKGLQLKTANGLFVDKSLKLLDSFLEDSKKLYQAEAFSVDFDPEEAKKQINDWVEKQTNGKIKDLLKDLDSDTVLVLVNAIYFKGKWKKPFDPENTKEEDFHVDEKTTVKVPMMSQKGKFYYYHDDELSCKVLELPYKGNASMLIILPDEGGLQHLEQSLTPETLSKWLKSLTRRSVELYLPKFKIEGTYDLKEVLSNLGITDLFSPGADLSGITEEKLYVSKAVHKAVLEVNEEGTPPEFKADRPFLFLIRENKTGSILFMGKVVNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Reactive centre loop dynamics and serpin specificity.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
molecule keywords Conserpin-AATRCL
total genus 96
structure length 352
sequence length 367
other databases KnotProt 2.0: Artifct K +31
ec nomenclature
pdb deposition date 2018-08-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...