6EKHY

Crystal structure of activated chey from methanoccocus maripaludis
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
121
Chain Sequence
SIVKTMIVDDSAFMRNILKRILSTTNKYVVIGEAANGADAIKMAEELQPDLISMDIVMPETDGITATKAIKEKTPEIKIVMCTSVDQEQKMIDAVNAGADGYIVKPFQAPKILEQFNKLFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Chemotaxis protein CheY
publication title Structure and function of the archaeal response regulator CheY.
pubmed doi rcsb
source organism Methanococcus maripaludis
total genus 39
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2017-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...