6F9OA

Crystal structure of cold-adapted haloalkane dehalogenase dpca from psychrobacter cryohalolentis k5
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
309
structure length
309
Chain Sequence
MKILRTPDSRFANLPDYNFDPHYLMVDDSEDSELRVHYLDEGPRDADPVLLLHGEPSWCYLYRKMIPILTAAGHRVIAPDLPGFGRSDKPASRTDYTYQRHVNWMQSVLDQLDLNNITLFCQDWGGLIGLRLVAENPDRFARVAAGNTMLPTGDHDLGEGFRKWQQFSQEIPQFHVGGTIKSGTVTKLSQAVIDAYNAPFPDESYKEGARQFPLLVPSTPDDPASENNRAAWIELSKWTKPFITLFSDSDPVTAGGDRIMQKIIPGTKGQAHTTIANGGHFLQEDQGEKVAKLLVQFIHDNPRHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cold-adapted haloalkane dehalogenase DpcA from Psychrobacter cryohalolentis K5.
pubmed doi rcsb
source organism Psychrobacter cryohalolentis (strain k5)
molecule tags Hydrolase
molecule keywords Haloalkane dehalogenase
total genus 114
structure length 309
sequence length 309
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2017-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...