6FABH

Three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
222
structure length
222
Chain Sequence
EVQLQQSGVELVRAGSSVKMSCKASGYTFTSNGINWVKQRPGQGLEWIGYNNPGNGYIAYNEKFKGKTTLTVDKSSSTAYMQLRSLTSEDSAVYFCARSEYYGGSYKFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of murine anti-p-azophenylarsonate Fab 36-71. 1. X-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
molecule keywords IGG1-KAPPA 36-71 FAB (LIGHT CHAIN)
total genus 44
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 1991-01-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6fabH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 6fabH02
2A77H 1AGCB 3FT4A 3L3JB 2DKUA 1T21A 2GQHA 4NQXB 3HC4H 4UIKL 3MRFB 1J1PH 1UXSB 3AXLA 3ARGB 2Q3ZA 2R2HA 3OAZK 1SHMA 4MD4A 5EPMB 4M8VA 2GJJA 1Z9LA 1VGEH 4QRPB 3QEGL 2CDGA 3SY0A 3REVB 3DMMB 3KPPA 2AJSH 1PYWA 1S5HB 3I9GL 4NO5B 3C2AL 4P57A 5J8OA 4M6ML 3BIKA 2IAND 4M00A 5I76A 1BOGA 2Y06H 5FV2A 5CEZH 4OLZH 4Z7QE 3FQRA 4WY7H 2CIKB 2KUTA 1RMFH 2E27L 3C5JA 3Q3GA 4PJEA 4QTIH 4Y2DB 3G04B 4LSUH 3MLSH 1S7WA 3NACH 1NLBL 5BOZG 5DQDL 4QRTA 2L7UA 1MUJB 2Y6SD 4Z7QF 3GSXA 4LAQH 4EQ2A 5ICZB 2GTWB 1NEUA 1CGYA 5B3JE 1E4WL 4YHMH 4YXLL 2AQ1A 5GRXG 3UROR 5MERA 1CVSC 1G9EA 2WW8A 1GZQA 4XXDA 5IGXH 1PX4A 1YYML 4NZJA 1BAFH 1EJ6A 4G7VH 3DVGB 5ADOL 4O9HL 3O3DB 2K9UA 2EEAA 4AL8L 4PGZA 3VJ6B 4KHXL 3CAFA 5D2LA 1D9KD 5LGJA 4XC1L 5L9DL 2ITCB 5T1MA 4JFHE 1E27A 4X6BB 1QVOA 4BZYA 5IMMA 4HBCH 3WJLA 5JXAL 5C1MB 4LSQH 3FO0H 3QAZC 4WI5A 3L5JA 3T0XA 2HVKB 5MEQA 2AJSL 1CL7H 4M93C 2X10A 2AXGB 4ZUTB 1VGEL 4HMCA 4TVPH 1G7HB 1N59A 4N90E 2DQIH 4IS6B 4JFFD 5E8NB 3UEZA 3O3DA 1WEJL 1C8PA 4FRWA 2VZSA 4J3XA 3FONB 2QHRH 5FUOH 1JNNL 1GZQB 3HZVB 4XXDB 5KVFL 1T1WA 1VACB 4U4BA 1MVFA 1PAMA 5L2KA 4GG6F 4BSVB 3ARFC 1HH6A 1CFQA 2QQLL 3DXAE 3ZTJG 5D7JB 3BMVA 4NNYA 3OXSA 4L8CB 5DYOA 1MCQA 2X1XR 3UPAA 4PJEB 3Q3GB 3KS0H 4Y2DA 4PRAB 1IGFL 4NNPH 1FGVH 4KKBD 3ULUE 1QRNA 2DDQH 5I8EB 2DTML 3VWJA 1CL7L 4QCIB 1JYNA 1A4JA 2CLZB 4WU5A 4UNUA 1BOGB 4LKCA 4XPFH 4ZTPL 2BDNH 4JKPL 2HH0L 4JREC 5F7WC 3TYGH 3ARBB 5FECA 1N8ZA 4HIXL 5IW1B 1FLTX 2BJMH 2DLEA 5TDPB 3K8KA 4U1IA 1YYMH 3UPRB 1NAML 1XEDA 3NH7L 1T2QH 5I17A 4WW2C 2ZNWA 2AAVA 1I1AA 4IMKA 1ZT1B 4KGLA 3PABA 1H15B 2QSTA 1NANH 3LV3B 5CEYA 5FYLE 5J06A 5FFLA 4Q9QL 1KJ3H 4NQXA 1JJUA 1SEQL 2X4TA 2XTJC 4CN1A 3O9WC 1X44A 1FFNB 2J12B 2XN9E 4N0FA 1N5YL 3DWTA 3KYKL 2HJFB 1FAIH 3SE8L 3TIEA 5DUMH 4AIZB 5GS1B 4LBEA 1MLBA 4M7KH 4X80H 1TVBA 3TV3H 1JK8B 3I3BA 3RVTD 3PP3H 1I1AD 4APQA 4YK4B 4PRIE 1HI6A 4H88H 4JRYA 1NLDH 3NFSH 5HI3D 3ZE0F 4C83A 5FA3B 4N0UA 5GS3A 4JE4B 3MYZA 3T3MF 4UTAH 4U1JB 1FC2D 3BISA 5BVPH 4Z0XA 1FSKB 1IC5L 4ETQA 2FATH 4U1KA 1IMHC 2XFXB 3JV4B 1AQKH 2EE6A 2WV3A 1LO4H 3INUL 5E9DE 5JOFB 3VH8B 1C1EH 4RGMB 4PV9A 3FRUB 5BRZD 4PRPB 4AZ8A 4I8DA 4JRXE 5F7EH 2BSRA 3KYKH 3SE8H 5D5MB 1KLUB 2FBJH 3O9WB 1DZBA 4JO3L 1LHZA 2WM0A 3IJHA 4Q7DA 4FP8H 1X5ZA 2CJUH 3KPSE 2J8HA 3BN3B 3BP7A 1QO3A 4M4RA 5L2JB 1GGUA 4LP5A 4FZEH 1WBYA 2EEBA 4HXBH 1A0QL 4E42A 4M02A 1U95B 4RNRB 1KCSL 2X44D 1A9BB 1A6AB 2YWYA 1OGAB 3VFMA 1JYVA 1MI5A 2P44B 4M7LT 4TNWK 5IVXF 1TQCB 4YPJA 5HD8C 4M3KB 5T1KD 5KSBB 4MNQB 5C7XL 5I1CH 2JF1A 1T04B 2HKHL 4PB9L 2Q76B 1P7QB 1I3VA 2OSLA 5CJBA 4P5MB 1BOYA 4ZAKC 4YGVB 4DZBA 2VNCA 4QXUH 5D7JC 1X5GA 3B9AA 3RGVB 3RIAF 2CMRH 4W4OA 5TQ2L 2GJZA 2F74B 2BVQA 3CJJA 1A6TA 2WLYA 2PXYA 3SE9L 1M7DA 1SJVA 1FBIH 2BNQD 1FV1B 1ZHNB 2EYSB 1ZHBA 4UNTA 2F8XC 3GSNH 4NJAL 4KMQA 2HRPH 4IIQB 4N0UE 4OTXH 3QDGD 3MLTA 5DURD 2NX5B 3O6KL 1NCCH 4L29B 1AKJD 4LASL 5ITBH 2OXHA 2YEZB 4P3DB 2E7BA 3WJLC 1IM3B 4RFNB 1OWWA 5DJ6B 1I9JH 5K59F 7FABL 4EEEA 3CNKA 4XPTL 4TSBH 4YXKH 1WC7B 2AK4A 4Y16C 2EICA 4RIRB 4KXZI 1XGPA 4KRPC 1UCBL 4LEXL 3VXSB 1G9ML 2CDFA 2E8ZA 3G6DL 3BKJH 2ILLA 4P48A 1CDUA 4D0CA 3X3FL 1J8HE 2VQ1B 5DGRA 1SM3L 3ARFA 1YNTB 4S10A 1AKJA 2NY1C 4EI5C 2ORBH 4IOSD 3BIBX 4I1NB 3H9SB 5HVHB 1XCTB 5DWUL 1XF2A 2BZDA 3VMOA 4NO2B 2VB5A 3BE1L 4JFOB 3VG0H 2QADD 3ARZA 5MENB 3DX7A 1E4JA 2J8UB 3O6LH 1KJ2H 2O26U 5IM7B 1QA9B 2PO6B 5B8CA 4OFDA 3MRCB 1AJ7L 5D70L 2YMXL 4RISL 5DLMH 3KWWA 1DN0A 3DI3B 4XP5L 2CLVA 5AZEH 3F5WA 4Y5YA 5EU6D 3QNYB 4WRLA 4LVEA 4U1SB 1NGYA 3GHBH 3ZKMC 2AXHA 1MSPA 3TGXA 4ZUWB 4LMQE 3AS3A 4NN5C 2WBJD 2X4UB 2H26A 1C5DB 3MODH 4S1QH 2CKBA 1K2DB 2MWCA 4Z18A 5I16A 4R0LC 5D96B 4RBPH 4Z7OF 2NW2B 3P73B 2ZPKH 5GGRY 3S88H 3L3HA 3VU2A 3B83A 3C9NA 4JM2B 1E6OL 1Y18A 4NQUA 1MRDL 2UVEA 2DI9A 5E6IC 2W92A 4OI9A 1NPUA 5KN5A 4HS8H 2AP2A 4X7DC 5FHAL 4LVNB 4FQXA 2FBOJ 3IXTB 4X6CE 1HQ4B 3ROOB 5J13C 1Q0YH 1RIHH 2Z92B 4FG6D 4HJGB 5DD3H 2X7LB 4BH8B 5ISZB 3O45B 5GZOD 2FB4H 4F58L 4CU7A 2VE6B 4RX4A 1ZANH 5I8OL 1WFOA 3GEWB 4KZDL 2EE2A 3A6OA 5EU7E 4Z77B 5ANMB 3QG7L 3SGEH 3BPCB 3OKNA 2QL1A 1A7NH 4ZAKD 5D7LB 1EHNA 1NCAL 3FQXA 3OHXB 4NPYB 2EYRB 3UDWA 1IE5A 3H42H 5GS2H 4F7CA 2QSCL 4PRPE 3FQNB 3W5MA 2WAHA 2DM3A 1CBVH 2NY2C 3DVFA 4HK0B 1FRGL 4Y5YB 1LP9F 4RMVA 3FB6A 1ZGLB 5J4MA 4J3TA 2NW3B 4IDJH 5FUCC 2LVCA 2YKLL 5DJZB 3B8SA 3TT1H 2B39A 5TQ0L 2NY4C 5C8JB 3JVGA 4YDIL 2IPTL 1VFOA 4P4KD 4TTDD 1NJ9A 2W60B 1FPTH 1ZHKB 5ELIA 4R6UA 3MCLL 2F54A 4MXWH 5IBUB 2QKIA 1JE6A 3OX8B 3OAZH 4ZOCA 3IDNA 5CWSB 3BH8A 1UJ3C 3SCMD 1GOGA 4BQ8A 4PRNA 1QBLL 4P2QD 5F9OL 1D5XB 3OJ2C 3JV6A 1AKJB 3UBXB 4XGZA 1NL0L 3FN0H 4K8RL 3SCMC 2EH7L 5EZOL 3QDHA 1P4LA 3ZYIA 4KKNA 3BQUC 4U1NA 1TJGH 4F15B 3MRQA 1VCAA 1CF8L 1JVKA 4ODSH 4U2YA 4MXVF 1EGJL 3CVHH 4CVUA 5JUEH 1LNUB 1XH3B 5FM4A 4J23A 1J05B 4YUEL 4Q6IA 4OZGA 5F7KC 2XTJD 3VFRA 1J8KA 1MHPL 3ZDZF 3GK8L 5LGHL 1FLRL 4P2QE 3RWEA 3O6ML 3CH1A 4GRWF 5BW7A 3HG1B 3WFBH 3O2VL 3AS2A 4JGJA 3ZL4L 1I3UA 2VXSL 3WV0A 1U9KA 2UUDH 3BQUB 4N0CC 3QT2A 1QSED 4KRLB 3E6HB 3IDIB 4MD5B 5FGCE 2BVOB 3SKMA 1UWEL 2R4RH 4XVTL 4D3CH 1DDHB 4JY4B 4WO4C 5F72S 1V7NH 4JFEE 3TO4D 1FV1A 1ZHNA 1FVEB 1U92B 2PW1A 2ZOLA 1R3LB 5DDHA 1IQWL 2YUVA 1BD2E 1OW0C 4Y4KC 3TH4T 3R1GL 5IVOA 2F58H 5F8QC 1UYWL 5JW3L 3CSBA 3RL1A 3OKMB 4M7LH 4PJIA 4DGVH 1GVIA 3MNZB 4YWGL 5FO7A 1YMMD 5DVKA 4LNRB 4YPGA 1P7QA 1CZ8L 1P4BL 1LWRA 1PLGL 2EIZB 3VRJA 1H8OA 1MIML 1HILB 2BHYA 2VDOH 2H9GB 3CPLB 4UT9L 2IH1A 3V5DA 3C6LB 4P49A 1YEKH 3MRRA 3G6JB 2DAVA 1F4XL 4G43A 5A1AA 4S1RH 3BGMB 3VFGH 5IHZB 3MRNA 1NANI 2DYPA 1A6AA 3V5HB 4HG4K 2WLZA 3T2NL 4NQEA 5A16B 4YFLF 4PV8A 3MRCA 4JFFE 1TETH 4HUWB 5KVMC 4K8RD 5I1IL 1H9VA 3MUJA 5EG6C 2V2XB 3MSPA 2J8UA 4G6JL 3SJVA 3I2CL 3OXRA 1RJZA 1KEML 4HCRH 2HKHH 1WFUA 5DRNB 2WWKO 3GSUB 1BQLL 4M43H 3W9DA 4NKMA 4OCXL 2OZ4A 2N7AA 3MNVB 5EZIH 1TZHB 5JW3H 1NMCC 1R3JB 2ZUVA 3GDBA 3BYYA 3NIGE 4PV9B 4J8RB 5CP3H 4YXHH 4ORZC 1KYOJ 4U33A 2A74B 1J11A 1MWAL 4KQ3L 3MLXL 4YNYA 3OQ3B 4Y19D 4KWUA 3BDBA 3V0VB 1KOAA 1EEQA 3KDMB 5J57B 2P1YA 3PXHA 4FN0A 3HPJA 1TXKA 5MEPB 3X17A 3IFNL 1P1ZA 3U30C 3UZEA 2CGRH 5ESVB 4FABL 4K9EH 2AV7A 1FYHB 2ESVB 3B9KB 4HIJA 2VR4A 5HDBE 5CBAB 3FCTB 4HWUA 4WU7A 4HS6B 1IGCL 4WO4B 2F19H 2W65A 5T5FL 4NRZA 1ETZB 4R3SA 4BSWA 2HJFA 3CVHL 2VUOA 1I1FB 1X5JA 3QHTC 4UT7H 3M8OH 1BD2A 2R1XA 5CJ8A 2BVQB 3HKFA 5I75B 1FNSL 1IAOA 1K3IA 5FYKD 3S37H 1NL0H 3RGVA 2Z93B 3CCHA 2HWZH 2FSEA 2GAZA 2NY5L 1EXUA 4PS4L 4Y7MA 5D72H 5LAXB 2MPAL 1BMGA 2VLKD 1CLYL 2JKXA 4NBZB 4OLYL 3CSYA 5JW4R 5BO1H 5IW1A 2HT2D 2NY6B 4NZTL 4PJBB 5FYKE 3V4UL 3EHBD 1MCKA 4KROD 1J8HA 3PWNB 5I8KL 3VXUE 5DQJA 3SGKA 5IW6B 1YEIL 1HIML 2N7BA 3E6FB 3SJVE 3DETD 1QLEH 3MBEC 2XXMB 4ZYKB 1K6QH 2PTVA 1JF5A 1BBDL 1R3KA 3WLWD 1DBKL 1B9ZA 1UZ8A 3H3PH 1RUQL 2YPLE 1X4YA 1LEKA 3LEVH 4RAUB 4IIQC 1IILE 1SY6L 2F53B 3T77A 3RBSA 1KLFA 4KUCF 1IGYB 4N5ED 1KBGH 3NN8A 1MHCB 4PR5B 3IJHB 5D7IE 1ZLVH 1OAXL 5LAXA 3BPLC 1BEYH 1H0DA 2C1PA 4R9HA 3U0WL 1ZOXA 5J6HB 2Y6SC 3DIFA 3AFLA 1A6WH 3PIQA 1IC7H 2XOTA 4WCYL 5HGHA 4XCFH 2IPUG 1RUKL 1Z0MA 3TYGL 4IS6A 4FQQA 5DFWH 3WIIH 2VXUL 5JOFA 4LSRL 4DKEH 2AXGA 4I3SH 5ERWB 1A1MB 4KAQL 2IALB 1K3ZA 1IEAB 2QSVA 4ETQB 5CJQL 5DZNA 4X6DE 4F7MB 4P5TA 4Z7UF 1I8LA 5FGSA 5BMFL 1S8DA 1RZJL 2Z91B 4L5FL 4HFWA 3MOQA 5DJAB 4PJ5B 5ESQA 2R9HC 2PN5A 2I9TA 4ZPVB 5SX5H 2C3VA 5MERB 3LSOB 1N2RA 4OF7A 3EW3B 1XGYH 4G80A 3EYSH 4LDOB 3MRIB 4Z5RB 2OK0H 4TTDC 2MJWA 5SX4I 4DVRH 4HWZA 3S97C 3OGCB 1S7WB 3JWOC 1C7SA 5E99L 3BAEL 2ZUSA 1MHEA 3ARFD 3ULVL 3TFKC 1JZ4A 5GISH 4Y4HA 4D2NA 5I73C 3LD8C 1UWGH 3CXHK 3F7VB 3QH3A 3MNVA 5H2BB 4HUUA 4M5YH 4E5XA 2UWEF 1WZLA 4U1IB 1S5HA 3GFUA 1FSKC 2VITB 4LF3B 5KS9A 4L4JA 4P23B 4P2OC 3SQOH 4C4KO 2DM4A 1FVCA 1LK2A 1NFIA 4L8BB 3PDOA 3C08H 4XVUD 3S35H 4D9QE 4LKCB 3D5OF 3RX8A 3UJIL 5KJRH 1A4JB 3ARUA 4YK4C 4GRLB 4KFZC 1OAZL 4TSCH 3ZL4H 4KVCL 4XNZB 1DUZB 1RY7B 4R4FH 3GIVB 3H7BB 5KSAB 4JDZB 3WS6A 5T1KA 4MHHI 4TVPE 3DO7B 1T1XB 1L6ZA 4IRSC 3WLBB 1YJDC 4OGYL 2Y4SA 1P84K 3EOTH 4N0YL 4HFUL 3V6ZA 1BM3L 4TUKH 1IEHA 2IH3B 4X4XB 2R29L 2X41A 3QEGH 4MAYA 4K7PY 5MEOA 3BW9A 1TITA 1F3RB 2JJWA 3TIDA 2HRPL 2A6IB 4AMKL 4PJAB 4R7DB 3DUSB 4BZ2L 2AKRB 2PW1B 1SQ2N 3F65A 1KB5H 4J1UA 5B38A 4RWYL 2VKWA 4O51B 3TN0A 2WBJC 5TQ2H 3ARED 1E27B 1FFRA 2FH6A 3C5SB 5CSZB 3TJEH 5LGJB 1CDBA 5IWLA 5IP4A 3G5XB 3IU4L 2L7JA 1FNHA 2YRZA 4NUJB 2EZ0C 2HT3D 1PZ5A 5HYIA 1F6FB 1G7JB 5JXEA 3MV7E 3BT2L 1ZHLB 4Z7VB 2DLFH 3TBVB 5L8JB 3W9EA 2VDRL 3QUXB 4Z6AT 3FFDA 4JPVH 1I9RH 4GKSB 2N56A 2ZSWB 4KI5E 1OARL 4ODWB 1QACA 1SYSA 1A6WL 1QPXA 4UTBH 1P2CB 4RAVB 1SJXA 1V7MH 5BS0E 4NOBA 4CMMA 1I8IA 1TQCC 4GOSA 1JRHH 2CJUL 3S96A 1W72B 4PJIE 4FP8L 1RUQH 4PGDB 5E8PB 3MLWL 3K8MA 4M93B 1SEBA 1URLA 4JO3H 5KS9E 3RTQC 5FB8A 4M8QB 5DMKA 1TPXB 2R2EA 4I3SL 3KPRD 4UDTA 3DSNA 2ZCLL 3N85H 3NCFB 5EC1B 3QJHB 4NQEE 5GQBA 5IR1A 1FL6A 3QIBD 3BHBA 5IB1B 1IL1A 3HFML 4DZ8B 3S88L 4OCYL 2ADIB 2WWKT 2FD6H 4GXVL 2E5EA 2P24A 1T21B 4MHHG 3JWOL 3WIHA 3L3JA 2WP3T 2ZOKA 3TT3L 4NPYA 1N6QL 3TC9A 1OP3H 3BPNC 3FQXB 4XX1G 2AJ3B 4OIBA 3M1BB 1PZUB 3CFCL 3BPCA 1G7MB 3S35X 5F9JA 4I48A 3VRIB 4Y88A 3MV7B 1FNSH 1MEXL 4QYOA 1IGMH 5E5MA 3ELAT 4NNXA 3GHEH 1HHIB 1RULH 3VI4F 5B39B 2FECI 3UJJL 3QSKB 5D71L 4Q0XL 4NHUB 1A14H 4YDKL 2CUMA 1UVQA 4X80L 3MLVL 3OR7B 3O4LA 4NZTH 1RIUH 4XVJH 3DTXB 2BVPB 5A2LH 3LRSB 1XCQB 1CLYH 5DEGA 3MJ7A 1FL3B 4PS4H 1UZ6F 5J9PB 2AEWA 2WZPD 2XZQH 3GSQA 4G6FD 4FFWC 4OQTL 1L9NA 4Y5VA 3MJ6A 3AY4C 2DIJA 1NBVH 4P9HL 4JFQA 3GI8H 4YDVB 1DUYA 3EYQC 4DOHE 1DQQB 2H26B 2X4UA 4NQCE 1KCRL 1G7LA 2XTJB 4D8PA 3WO4C 2NNAB 1J1XL 3VG9C 1UCBH 4D0DA 4M7JH 2NY0B 2VOTA 2R4SL 2ZWLT 4G3YH 2X1WL 3MO1A 3JWNC 5I71C 3KJ4B 4EZMA 4NQVB 3TESA 4X8JA 3BRDA 4OLXH 1JGUL 3U48A 1NCCL 1JP5A 4KXZH 3RWIB 3H0TB 4LCWA 1AGDB 1NC2B 4APQD 2OR9L 5E95B 1LE9B 1WIPA 1DP0A 3H7LA 3S5LA 3J8F7 2YUZA 4GJTB 3EJZC 4GBXB 1Q94A 1JNNH 1T0MB 3X13A 1NCWL 2H1PL 3S98A 1E28B 4MDIA 2EDXA 5DR5H 1WF5A 1D6EA 3JV5A 1EEUA 5FO8B 5SWQB 1CVRA 3WS6C 1QZ1A 1LO3H 2AJYH 2GTZB 3LN4A 4JZJA 1OP9A 1FP5A 3VXSA 3WMSA 1NSNH 5I1CL 4OGXL 1DANU 4UAOB 4P5KB 2OJEB 1HXYB 2NY2D 4EDXB 2BVPA 2EH8H 2UY6A 3C8HA 3G6AA 4ZXBB 5E1AB 3BKYH 4XMKL 3O4LB 5E6ID 4OQ1A 2SEBA 4N8CL 4LSVH 3EJYC 3FQWB 4XB7A 4W81A 1BJ1J 2BK8A 2WUCH 2V7HB 1AGFA 4XPBH 5I19L 4E41D 3RUGE 4N9GB 3BO8B 2Z35A 1CG9A 1FG2A 3D69B 4OCSL 5JHDA 1YECL 2Q8AH 2MMXA 3MV11 3IFPA 2ZOKB 1I7UB 1B0RB 2PXYB 3C6SB 2VSDA 4Y19B 1A6TB 4KTDL 3QNZB 4JZJB 5FHBH 1A3LH 4N8VG 1YEDB 3WUWB 1T4KB 1XIWD 4FFYH 3PV6A 5ICYA 1SJHB 5IESL 1UB5B 3FFCB 1F4YH 4F3FB 3I9GH 5C2UB 3VXNB 1AGEB 1T0MA 4MVBC 4NFDA 3HRZA 4O2EA 3IDJB 3MXVH 2Y7QB 3E8UH 3LDBB 5JMOC 5DJ8A 4NJ9H 4L9LB 1W72A 2ZCHL 4RA0C 4WDIA 5CEXA 2KZWA 2BNQA 3EYUL 2NY7L 3QEQB 2CXKA 4G6ML 5JQ6H 3LB6D 3EFFA 3B9KC 4LLDA 4NQVA 1ZVSA 4CMMB 4MSWB 1AY1L 2HKFH 4RCAA 4XAWH 5C0DA 4RAVA 2ICWA 1WICA 3ULSA 1FQ9C 1CICB 3B9KD 1R6VA 1TQBB 3VGFA 4JKKA 3NAAH 5HHMB 4D0DB 1A7PH 5IVXE 4N9OB 1KCUH 4YDKH 1FGNH 5F9AC 1EJOL 1QG3A 3BH9A 4JFFB 3EAKA 4I0PD 1HE7A 4R4BA 3RUGF 1CBVL 4QHUB 4G7YL 2X40A 1UM5H 3QDMA 4Y89A 4XVSH 4ZSOB 3N9GL 5I1AB 1VEOA 2NZ9C 4DVBA 3GSQB 2VLJD 2I60L 3RU8H 1MNUL 3JV4A 1ZLSH 2Q8BL 1OB1A 3M45A 3V0WL 3ZSTA 1KTDA 1RURH 3SKJL 5HVWA 1MCOH 1AHWA 4RFOH 4Y4FC 3U46A 5JO5A 4UTBL 1XCQA 3RHWK 2FX7H 4OZIE 4YHPB 4NKIL 1X5XA 4S0TD 4KJWD 2AKRA 2GSIA 1F11A 2AV1A 4ZO7A 4JPVL 4ODTL 1TFHA 4Z7NF 3BW9B 1VGKA 3RNQB 3SO5A 5F7FA 3RWDA 1CK0H 5K9KA 5CAYB 3MV7D 3DX9B 1FL5B 5GRYA 3WFZA 1T1XA 3NAAL 3FN9A 2AJ3A 3GIZL 5DD1L 4XPGL 4Y5VC 5D7IA 3GMPB 3H7BA 3CD4A 4OZHE 3FTGA 1CGWA 1YMHB 2IMNA 3BESR 5FKPB 1RUPL 3TBTA 2NY3D 1IGJB 3HUJF 3G08A 4JDTL 4Y4HD 2IANB 3O4LE 4L3EB 4S1QL 4WNQB 1M7IB 1ZANL 2Z8SA 2AK4D 4JM4L 5INCB 1KIRB 2NR6D 4UU9B 4F58H 5D2NA 3PABB 1A3QA 2C7UA 2XNAA 2AK1L 5CCKL 1CLOL 1T7ZA 2EO1A 4LF3A 5KS9B 3FO2A 5CP3A 2YSSA 1KT2A 1BM3H 1D5ZA 4TUKL 3U7WL 4GS7C 1JWMB 2AJXL 4WHTA 1BZQK 1CTNA 3WFEL 1ADQL 5JXAH 1MF2H 4GXUN 5CD3A 1JWSB 2G9HB 5IOPA 3SDAD 4ODBD 1L6XA 2W91A 5H2BA 1TZGL 4WIQA 3F7VA 3QH3B 2JK5A 3U7YH 1BZ7A 2DQFA 3UTPD 1HSAA 1FORH 4NDMB 2VABB 2OTWB 4CU8A 5K59E 4LU5L 3FQUA 5DWUH 1EBAA 3MFFA 1U8IA 2D03H 4IHOA 1F02I 4LARH 5HHPB 4PJFB 4FQCL 2PYFB 3SQOL 4BSVA 1CICC 3ILQC 3WHXA 1BVLA 4MMZC 4NN7B 4FA8A 1T1WB 3ARBD 1RZKH 5FYJD 3GJEA 4JZJC 3EOTL 4N0YH 4XZUB 3D85B 4KRNA 4G6KL 2VN7A 1AI1H 4KPHH 2IBZY 4MZ2A 4ZUTA 1N7ML 4JGUA 5I9QB 1S8DB 1AR2A 1DBAH 4DW2L 3DV4B 3TN0B 3O6FC 4CVZB 2VDLL 4S1SH 3G9AB 5TPWL 1YY9C 3RX7A 1HKFA 3B43A 2A6IA 4YX2L 5C0CD 2AXFA 2DQTH 3GI9H 3UTPE 5F7HA 2XQYK 3WDHA 5J6GA 4XZUA 3UBXI 3CDFA 3N1MC 1Q8MA 3K2UL 5FO9A 4G9DB 4KRPD 3NPSB 4K94H 3WLBA 4M5YL 3R06B 5T3ZD 3QWRD 1DVFA 5EIIA 3UTTB 3VA2C 5T3ZE 3RVWC 3KPNB 2J88H 5L88L 5GISL 1UZ8B 4QRPE 2ED8A 2R2BB 1P7KB 3DV6B 4NM4L 5I1EH 3AB0C 5LQBH 4EN3B 1YJDL 3FT3B 3FO1B 1LK2B 1NFIB 5IJKA 1RI8A 2B2XH 4DK6A 1OM3L 5DFTA 3PWPD 4P23A 1BX2A 1INEL 4NO5A 2P7TB 4MJ5A 1RAMA 1AQDA 4DWHA 1EVUA 1KT2B 3DMMA 1YC8A 3KXFA 3KPPB 3CLFL 3AM8A 4K7PH 3RQ3A 3NVQA 1UGNA 3P30L 5I71B 4YBQC 5T33L 1OAXH 3V0WH 2CMRL 5TF1L 1F90L 1SVCP 2Q86A 4KI5F 5D2NB 2EXYC 4Y4KA 2NY0C 4WNQA 5BV7L 3LEVL 2VDML 3VG9B 4ZFGH 4QT5A 2VL4A 3F58L 4PJ5E 4RGND 4MAUL 1YMHA 4QF1A 4NC1C 3OGCA 1S7TB 5DGQA 3GMLB 4DUWA 4XVJL 5H94B 1X6NA 3RPIB 3WFCH 1ZMYA 3SHSA 4ODTH 3DX9A 3DMMD 4CJ0A 4K7FB 1CDGA 3U6RA 4X8XA 5JA8B 1A7RH 4X98B 2HLAB 1A14L 2Z31C 1FJ1B 3D6GA 3GBMH 3Q6FB 5I1GH 5CBAA 1S9XA 5EBMB 3EYFB 4HIIA 2DQHL 3I75B 1KN2H 4HFWB 1B2WH 5EBMA 3MGOA 1FZJA 3NMEA 2R9HD 5JIHA 4GLRH 5CZVH 4WFED 5K9OB 4MQXD 4YHPA 3H3PL 5JO5B 1KTDB 3RPIA 1EGJA 1AIFA 1OB1B 5TGBB 1KULA 1A6VL 1S78D 5L0QC 3GBML 4ZSOA 4JN1L 3VXQB 1JF6A 1UEYA 4HEME 4B41A 4PUBL 3DXAB 3L5WB 1MCSA 3IJSB 3ARWA 1R3JA 5K9QI 3KR3L 3O3AA 5IBTL 4WFEE 3HB3D 4JKMA 1NFDB 3K8LA 4UOW1 3S34L 1W2KT 4ZFGL 5CD5C 2ATPA 1A7BA 3KJ6H 1IGYA 4AY0A 4KRPB 4S2SA 3LKOB 4OCNC 1I3GH 5D93C 32C2B 3FQTA 5MI0B 2A73B 1B2WL 4Y16B 1JGEA 2XTJE 1LO5A 2O93L 5TF1H 3C8DA 5CUSL 1U58A 4H0HB 1Z9SA 1NGQL 3QUYA 3MMEA 4PJIF 5A16A 1N6VA 5CS7A 2YD9A 3RY6A 4Q9CA 2R0KL 1I7ZB 3QFDB 1BIIA 1T7WA 2ZUWA 4XNYH 4MCZA 1FFPA 4PGJA 1JNHB 3ULUH 2IH1B 4PJDE 3V5DB 3TZVD 1JPST 5IG7A 5DVNA 2VXVL 4LLVB 2EIZA 4HWEL 4G9DA 2X42A 3EOAA 2P5EE 4U7SA 1N64H 2Q7YA 4NUGL 4YZFF 1QBBA 1SJHA 1LO3L 5J11C 3BD4A 4KMTH 1T4KA 2Y25A 2AXFB 1BD2D 3L3DA 3BYTA 4NWTH 3QNZA 4ZAKB 2ZCKH 5D1QC 1R3LA 1TPXC 3ZHKA 4XH2B 1I1FA 2BMKA 1FVEA 1U92A 2WUCL 5GS2D 1KB9K 4HEPG 2OM5A 4XBGB 2OL3L 4CVZA 1FIEA 4TQEL 1CFSB 5GZND 1YEKL 5EU4B 2EH8L 1WAAA 4BQ9A 2W59A 1AGFB 3I6GA 3CVHB 1H8NA 3BQUA 3MBEA 5EBLB 1KEMH 4HCRL 4XCNA 2I27N 4HBCL 4EI6A 3DBXB 4WHDA 4WV1C 4HKBA 2Z4QA 4JFXB 1KXQE 5CJ5A 3EDFA 3DRTA 4NYLB 5DRZA 4PJFA 3CU7A 3IXAA 2IAMA 1ZXQA 2D7MA 4OM1H 2P47B 5GGUB 3K2UH 1CQKA 5E2VL 1BQHA 2HT4D 5KVFH 3EDEA 4LLWA 3BP4A 2YD8A 2A6JB 1RSFA 4TNVK 4DKFH 3O41A 3VXUD 1QOKA 4YO0B 1FN4B 1E28A 4J6RL 4MDIB 3MJ9L 1B4RA 5D1ZB 4XNZC 1EZVX 2CPCA 4X5XB 2XKNA 1ZTXH 1ZA3B 2IFGA 4TNWF 5E2UH 2OMBA 3LMJH 5DRNA 4HWEH 2VXSH 2YZ1A 3N50A 1OGTB 3IKKA 1GGBH 3WIHH 1FCGA 4ZQKA 3SDCC 3ZZ1A 4JFYB 4P5TC 4JFHD 3U7YL 5D93B 3N1PC 5LCVH 3SDDB 4ZS6D 5TDNA 1EERB 4EQ3A 2N4IA 3C2AH 4G6KH 2C7UB 2FR4A 5FM5O 5E99H 3DVNA 1U3ZA 4AEEA 5ISZD 2NW3A 2CXGA 2YRLA 4DVRL 4F9PC 1YEGH 1Y6KR 5EUOA 1KJ2A 4X7TB 5C0AE 3BRGC 1GGIL 2EYRA 3TA3B 1AE6L 2V5YA 1IRAY 2WINA 2EDRA 3LD8B 5D7LA 3JTTA 4J2XA 1OT1A 3LPGA 2OP4L 2A83A 2B20A 3QXDB 1MCIA 3T1FA 5GXBB 1HXMB 5IMOA 5D1XB 4XHQA 1GZPB 1HCVA 2FD6L 3H9HB 1AXSB 4OSUL 3KR3H 3QG6A 1R5VB 4PJ8B 4AM0B 5ISZA 1OGAE 4HJGA 3D3VB 5TQ0H 4X4YA 3IXTA 1QSFE 4TRPH 4RSVA 5D71H 3DARA 2M8XA 1LGVA 4Z95L 5CZXC 35C8H 2WIIB 4RGOH 2E9WA 1H3PH 4YR6B 2BVOA 2AI0H 3EKCA 2VDKL 3C9NB 3V7MA 1A7NL 1BECA 3U0TB 4C56B 5LJYH 1U0QA 4H8WH 2EDEA 4K3JH 3U4EA 1OAKL 3BKCL 3DYOA 3PNWA 1QSZA 3VRIA 3QXDA 3MCLH 1KBGL 4XPGH 2VZOA 4TPRL 4R4NC 3P77B 1YEEL 1J05A 1YNLL 1NGPL 3TT1L 1S9YB 3GMOA 1J88A 3WNKA 1X4ZA 3KAAA 2ICWB 3FFCD 1N26A 1FE8H 3I6LD 4LLYB 2FYYB 1BIHA 3QXWA 3HE6D 5SWZA 1LK3H 1MAMH 2VDQL 3JV6B 1A4KA 1RZ8B 4BZ1L 2DQDH 2BNQB 5A3IC 4JQXA 1E4KC 5CEXB 4GKNA 1A2YB 1PD6A 2H2PD 4ZQKB 1TDQA 3MGAA 4K3JL 4YQXL 1SEBB 1X3DA 2E7CA 3MREA 4GSDH 1XMWA 2F54B 1KB5L 2I9LA 2NY7H 3EBAA 1RZIA 3KPSA 1UJTA 3Q2CA 4BSJA 3U2SB 2AI0L 1S78C 1CFNA 1UB5A 3FFCA 2FYYA 4JN2A 4DUVA 3BD3A 3X14A 2GITA 5FHAH 4A2LA 3DO3A 1HDMA 4ODWA 4LLWB 3H9SE 3LH2L 4NC1E 4HWBL 1IAIL 4F7CB 3P4LA 3FFDB 4FTVD 3VD5A 2OI9B 4RMRA 1Q9LB 5DRZB 5E9DA 1QTYT 1G7IA 4RIRA 5I74C 3W9EB 3IDXL 1WWCA 5HSFA 1ZHLA 5EU7C 1A3RH 1G7JA 3KPSD 3MBEB 4NUJA 1OAZH 3OGOE 3CVHA 4W4NA 2V9RA 3FQWA 1PJ9A 3UJIH 4J6RH 3VD4A 4KZEL 2DQTL 3GI9L 1BVKA 3G9VA 4IIQA 4YX2H 1OCWH 3QEUB 4DKFL 2WIIA 4P5KA 3QDME 3BVNA 3MJ9A 4OGYH 1A6ZB 1X5IA 4LEXH 2GJZB 1DQJB 3L3DB 4JG0H 1N0LA 4LIQE 3H9HA 2AS5M 2A9ML 2IH3A 4KVCH 5INDA 1I9JL 2IAMC 4LGPB 4Z7WB 5HYSA 1T04A 3LMJL 1KB5B 3WSQL 2F5AH 1C5DA 3CXHJ 3HG1E 1OPGL 4PRBA 3O9WD 2RB8A 4P2OD 1LE9A 4H26B 3NA9L 3QFDA 1T5WB 2P48B 1ONQA 3GSWA 2VO5A 6FABL 4RMWA 4MWFA 3ZKSD 3WN5C 4KKBC 3RWIA 5DSCB 3RKDD 2RFXA 3U30B 1CXLA 4JY6B 4PGCA 3FZUD 2VZTA 1AD0B 1Y0LA 5D8JL 4KROB 1MJUL 1QA9A 5AAMA 2LABA 1JHLH 3MO1B 1IZJA 2BP3A 4EOWL 5E03A 2VITA 3R8QA 2OBGA 5BMFH 1NBZA 5FKAB 5C0AA 1XF2B 1G7LB 2AJXH 4P4RB 4CDHA 5C7XH 3O9WA 4Z0BH 3IS1X 4NGHL 4YDVA 2A0LD 4AIXA 5IHLB 5HI5C 4CADB 5F3HA 2XZZA 1T83C 3O41B 1EUUA 2O5ZL 1S7QB 2YA0A 3BP4B 4OBSA 3S37X 2XWTB 5DK3A 5SWSB 2AABH 2CDFB 4HCRA 4KI5D 5J7CC 2MQ0A 1VENA 4APQC 3QIBA 4D3CL 1PGRB 2YK1L 1XGPB 4JFDB 1UWEH 3RWGA 5BS0D 3KYAA 1HINL 2Z4QB 3SOBL 4OB5H 3TYFA 4CMHC 3QWQB 5IQ7L 2R0ZL 3C5ZA 2EZ0D 2OYPA 3UC0H 1A5FH 3KPQB 1V8HA 1RZFL 2VYRE 4PJ8D 3ZO0A 4NHUA 5EUOE 4L29A 1G9MC 3VXRE 1HHIA 1A7QH 2BVEA 4X4ZA 5EU4A 1YA5A 4DN3L 2XA8L 1NKOA 4ORGA 1C1EL 4XBGA 3ABZA 3LS5H 4ZUSA 2OR8A 4XH2A 1JMXA 4N0FB 2FX7L 5D9SB 3U36A 3RVXC 3HC3H 5I8CA 1DEDA 2P24B 5C0ND 2BC4A 3AAZB 2Q8BH 1INDL 4ZXBD 3OKYA 3O4OB 4Y4KB 4YIQB 3L5IA 2VL5A 1VFAA 2Q86B 3UTTE 2H3NB 3ULUC 3EOAB 3S34H 3MACL 5ACMA 3QJHA 5IR1B 5TDPA 4XP4L 4O5LL 4OF0A 1FFPB 1BIIB 4OV5B 3WIFB 2DI7A 1MQKL 5EC2A 4LRIA 4QO1A 1RZJC 1R3KB 5ESAB 1RJCA 2XA8H 2BY3A 3QP3A 4Q0XH 1CE1L 5IHUL 3VXRD 5HHXL 2P8PA 4QY8A 1PY9A 1I3RA 4HHAB 2BNUB 1MFCH 2DBLL 1DBJH 3QUYB 4QCIA 3WUWG 2AEPL 3PWPA 4P23D 5LXGH 5BVPL 4PJCF 4XWGH 5BV7H 3LKOA 4JFPB 4OB5L 4XP9H 5D7JA 3MLUL 4NJ9L 4HMDA 1MCLA 1CFQB 4OFYA 4JRXA 3EDJA 1QNZH 3MXVL 3MLXH 3HC3L 2PXYC 2I5YH 3HZVA 4KTYA 4LCWD 2YD4A 1HK6A 3W11C 5J6GB 3FB7A 5L8KB 3JTSA 4LCWE 1OM3H 1IGCH 2H2SD 4XPFL 4ZTPH 3GMNA 4JO2L 1NEZG 1CXFA 5T1LA 3BT2H 4POZC 1U6AL 2BY1A 5J12C 4XNMB 3BQUD 4HGKC 3MBED 4KDVA 4RMUA 3LEXB 3TEUA 3MGOB 2NY4B 3DUSA 3HE7C 5IVXB 3SGDH 5J13B 4IM8A 1LO2L 3TIDB 1Z3GH 1DQLH 2P5ED 4DAGH 2YUWA 2QJDA 3QRGH 5KSBF 4Y5YC 2APTA 5E6ZA 3P11H 4HIXH 1QFPA 2ED7A 4WUUD 2NY5C 4N8CH 2PYFA 4XTRD 5GS1A 3PJSB 1MUJA 4K3EL 2VLKA 3GSOA 4EI5A 1E4XH 3MUHL 3TZVC 4UT9H 4S1SL 3QEHB 5E1HB 3WSQH 4K2UH 1ACYL 3FO0L 5EUKB 4UI2A 3VXTB 1GC1H 1KENL 4V1DA 1U8MA 1K8IB 1IKFL 1DR9A 1GIGH 4HKXA 3P9LA 4ESKA 3ESUF 3D39B 1IBGL 2ADJA 4M9OA 3I02A 1KJ2L 4X4ME 5F7NC 5AZ2L 4GMTL 4HQQL 4P57B 4PIRF 5C08D 4P4KB 1PYWB 3H9YA 1MI5E 3KXFB 3T2NH 3TCXA 4D94A 1AQDB 3QPQD 3UJTL 4E5XB 1V05A 2VZUA 1RJYA 2NLJA 5EPMA 3X3FH 3GJFK 2BVUA 1K4CA 2CR3A 1QRND 4FG6C 4HKXB 4H5SB 4Y4HB 5CBEA 1U8MB 2MTPA 1BLNB 2GK2A 4LSQL 3FTGB 5HVHC 1ZGLP 3UDWC 4IRZL 2VLKB 3GSOB 5C08A 3GSRA 4ONFH 3FO9B 1QD0A 3IFLH 1K5NA 3ARSA 3CZJA 4JHBA 3OF6A 1EGJH 1U8NB 5TFSL 2J7LA 1ZK9A 4P9HH 5DJAA 5C0RH 1QR1B 2XWBA 4OT1L 5C0BB 4MNGA 1JHKH 3L3OB 5IJVA 5DDHB 3P9WB 1XGYL 2FRGP 5D5MF 3THMH 3PGFH 4NQSA 1J1PL 2BX5A 2WMPA 2ERJB 4O02H 2E27H 1OD7A 1R0AL 1FORL 4MB5A 4G6AD 1HNFA 5D1ZC 2OJZL 4MXQC 3QIWD 1BBJB 4QXUL 5B38G 1TZGH 4EUPB 8FABB 2VLJA 1MHPH 3D0LB 1JN6A 1GC1L 4BM7A 1NGWA 4C58B 3QPXL 1WGOA 4IJ3C 3F6IA 1KV3A 3BMWA 3CH1B 5CHNA 4QHLA 4FOMA 1H0DB 2C1PB 4YDJB 5DHVB 3NTCH 3S9DB 3D3VD 1IGTA 4WUKL 4U1LB 1NDGB 3T77B 1FYTA 1NCAH 5EWIH 1CICA 2BFVH 2DB8A 5E94A 5JW4M 4U1NB 3PWPB 1UC6A 4WEMB 1RURL 3AS0A 1HSAB 3SKJH 1F42A 4H8WL 1I9IH 2DQFB 4MXWL 1L9MA 1WCQA 4QY8B 4HUMB 2FWOA 4B50A 4YLQT 3MRBB 4KJQD 1JNLL 2HLFC 2D0FA 3Q6GL 3S7GA 4GG8A 5IOPB 1J8HB 3PWNA 1U6AH 5FYKL 3FMGH 1D5ZB 4NO3B 5HHVH 1MAJA 3CMOH 5JPMB 1U91B 3GJFB 4X6FA 1OW0A 2H6PA 4FFWD 2H3NA 4MD4B 3H42L 2A1WL 4LLUB 1C08B 4MNQD 5LWYL 4QRPD 2YA2A 5D6DA 1OY3B 5ICYB 4WCYH 1ERNA 1ZGLA 3FB6B 2BC4B 2O61A 4HK0A 4J4PC 5FKPA 4AENA 1OF2B 1AGCA 2WUBH 3C2SA 2AJZA 3GMPA 3CDGA 1IT9L 2ENYA 5GGTH 1MJ8L 1AE6H 3ARDA 5C6TH 4P9ML 4LLMA 2JLLA 5HDLA 3NTCL 4WO4A 5AUMB 1YEGL 3BO8A 2ERJC 3E2HB 1VGKB 2AV7B 3B9KA 5DVLA 1T1YA 4BQCA 4C4KT 5ESVA 3VD3A 2YMXH 2ICWJ 4UV7H 2VLME 4WFGD 2Z92A 3F7QA 2CKNA 5IJKC 1F2XK 4FQXB 4YBHA 4OZ4A 4M1GH 4YFEA 3TVMD 3NPZB 4JJ5B 4I13B 2OJEA 5KN5B 3BX7C 4JEGB 4QEGA 3LKPA 4FTVB 1T0PB 2FX9H 2XG5A 1FFQA 2FIKB 3D1MC 2C4FT 2A74A 4KK6D 4X7CC 5KG9B 1M1SA 1KJVA 2EDJA 2UUDK 2DIAA 2ZCHH 3IETA 2FO1A 3ARTA 2Q3AA 5EBWB 3NH7H 1D6EB 5GGVY 1RUAH 2XKUA 3QQ3B 3MOAH 1K2DA 5FOBA 4CN4A 3K80A 2BJML 1IAKA 2V5SA 1JPTL 5C6PB 4CU6A 1VADB 3P0YL 4HAFA 4KKCC 3T3PF 3GMMB 3TPUB 5BXFA 4LPCA 3TCLA 2XG4A 3PWPE 1EMTH 12E8H 2Y07H 1NBZB 5FKAA 5C0AB 4FNLH 4RMSA 4Q9BA 4U1SA 5F44A 1T20B 2VR9A 2X1QA 1JPSL 2BRRH 4PTUA 8CGTA 5F7DB 3IDYB 3V6OA 3IF1A 4K9EL 3QCVL 4HUWA 5IT2H 2VLMD 1NSNL 4P4KC 2DQCL 5JR1H 1JZ7A 4JY6A 2B4CC 1ZTXL 1LE5B 1NGXB 4HH8A 1S7SB 3MA9L 3WFDL 4FQLH 4L4VE 4MWFB 3ZYOA 4OTXL 4ZFFB 4RGNE 1WV7T 1CDYA 5GJTL 5FYLL 4FQ2L 1A1OA 1YEFH 4FQPA 5DR5L 3BZFA 4KTEH 2R1WA 4U1GB 1P5UA 4WFHD 3MX0A 3SGDI 1ZEAH 1HILA 5DUBA 3W39B 1G9MH 5FOBB 1BPVA 1CE6A 2CRIA 3MLRL 4D0BB 1U3HA 4QRRE 4Y16D 5FO7B 1F4XH 4LIQL 5EZIL 4WW2B 4D0CB 4MLIA 1G1YA 2X4QB 5DS8B 4LEOB 1ZSDB 2VDOL 3SE4C 3WFHA 1S7VB 5JOPE 3QUXD 4I5BB 1AH1A 1VERA 3DETC 1N64L 2FIKA 2V5MA 4KKAC 4FTVA 1ULVA 3BVNB 2FO4A 3IFPB 2GCYB 3BPLB 4KK9C 5BS0A 3TBWA 1D5IL 3LRSA 3BSZL 3ZE1E 1WC7A 1V3KA 4XNYL 5EOTA 1HEZB 4MS8C 1EO8L 5GSRB 3QUZB 2R0KH 1UVQB 1H3XA 3WJJA 4DQOH 3IGAA 1CCZA 3P11L 3VD7A 3O3EB 2D0HA 1I7RB 4HGMA 4KTEL 3BRFA 4NWTL 1DTUA 5JW4Q 4FZEL 5E70A 1RZJH 3R8BB 3ET9F 1QLFA 5E9DB 3L5XL 5EFIA 1P5VA 1MCNA 4OLXL 3U0PB 4KJQC 1CDCA 3OKDA 1OF2A 1RU9L 3WFBL 2NQCA 1ZSDA 2GTZA 1BVZA 3X14B 2R4SH 5BV7C 5D7IF 5FO8A 1YNKL 3GSNB 5I2IA 1C7TA 1EUTA 4QRSB 4PYGA 2VTFA 3QUMA 5EULV 3LS4H 2APBA 2FHFA 5DUBB 5EC1A 3MR9A 2XXCB 1E4XI 4YHOH 3PQYB 2R2EB 5EIVA 4N68A 3EUUA 3VXRB 2M2DA 4FHBD 1OGAA 4FXKA 4GG8B 5JTWA 4G8GA 3ZLQC 3MRBA 1U95A 4RNRA 3U1SL 4OJFH 4GRWB 1LE5A 1A4KB 3V6FA 3WNLA 3PGCB 3LQAC 3T0AA 3QWRA 2NX5E 5F96H 2DQHH 3PG2A 3OZ9L 5F7MC 3LKSB 5HYFA 4M1GL 1FYTB 1S9YA 5AWNL 2ATKB 2YBRA 3RVVD 2EC8A 3PHQA 4OFYD 3PDGA 4M7KL 2NNAA 4PUBH 1MQKH 2QR0A 2X89A 3MLZL 3KPMA 5JDSA 2EXYD 3GHEL 4LDEB 1KLUA 4FTVE 3P9MB 4JY5L 2BSRB 4Y4HC 1H5BC 1IC5H 2NX5D 2J5LB 2NY5H 2OL3B 1MVUA 3VFUB 1YUHB 5F8RC 3K74B 4QHKJ 3P0VH 5HYJA 3VH8A 5KG9A 3CFBA 4HUXA 5C0JB 4XPAH 3ARDC 1T7YA 3TO2B 1HQ4A 3ROOA 4CAGA 1UG9A 3K2MC 2ADFH 1IFHL 2EDLA 1EEZA 4O51A 4Z0XB 3MJ7B 5BJTB 4J1UB 3MJ8B 1GC1C 4F2MB 2ICEA 4PREB 4NQSB 1QBML 3BGAA 3TA3D 5DMGD 1INEH 5HVGB 3ARGC 4PJ8A 5J89A 4NC2B 1KYOK 1LO0L 4LCCA 4MNGE 4FZ8H 1AXSA 4EXPX 3P73A 4NNXB 1GPOH 1R3HA 4HIEA 4NM4H 3RPKA 3FMGL 2FNBA 4MDJA 4QYOB 3T1FB 3MRPB 4CL7A 3HAEA 5DFVD 3VXSE 3SQBA 5F89A 5TF0A 5JOEA 3A6CL 3L7EA 3SOBH 4NCC1 3BUTA 2MHAA 2YRPA 1R3IL 2BHUA 2C4XA 3D3VE 3BKCH 5EUOB 3TO4A 1RZGA 4PPTA 1RIVH 3U83A 2JJUA 3QDJE 1JBJA 5C0FA 3DVNB 3NIFF 1H15A 1JPFA 3B5GA 1NC2D 3G5ZB 4I18A 4YEEA 2HT2C 1KTLA 4XNUH 5DD3L 3L1OH 1YYLL 3EZ8A 5DVMA 4U31A 2VDRH 1J86A 1P7QD 3UPRA 2R0WL 4RGOL 1ND0B 5DMKB 5SWSE 3F7RA 3HUJB 3NIGF 5FECB 3TJHC 4F7EA 3W2DH 4P99A 2R8SL 4PRHE 4U6YB 1XCTA 4DN4H 1JFQH 1T0NA 3VXME 1N7MH 1MPAL 4NZUL 5KZCD 1MJUH 3W0WD 5JXEC 1H8SA 4B5EA 4IRSA 4XCCL 4KHTL 5ADOH 2R23A 4XCYA 4MGXA 3BP6B 1SYSB 3KLAA 1AP2A 5C3TA 1A64A 3OXSB 1NDGA 5FYJH 1MCFA 3QR2A 3S35L 4LCUB 1FVDB 4FQCH 3PJSA 4HKZA 1GYAA 2P5WA 4YDJA 5DQDH 3SJVD 4NYLA 4U6VH 1F8TL 1G84A 3STZA 3TBVA 3UCRA 5F1IA 5DQ9A 3GMRA 5J3HD 4ZOBA 4PJ9B 2DQUH 3DNKA 2DLTA 3LEYL 4JQIH 5CILH 5EBLA 1CZ8H 1P4BH 5F6HJ 1VA9A 4P3DA 2YEZA 3BP5B 3P4MA 4XC1H 4DGVL 4F80A 5L9DH 4K71B 5DJXB 3SBWC 4QXWA 1E4KA 3ARQA 4FMKA 4ZDHA 3VG0L 4MQTB 4PLJD 5IMMB 5BRZA 4U6XB 1OAUH 3VD9A 1Y6MR 4JAMB 4LVOC 5GRVL 1YC7A 2F74A 5C0BA 3QJFB 1CDHA 1KSRA 1QR1A 3DVGA 4PRDA 5FYJL 3GNMH 3VWJC 4LMQI 4YGVA 1WBZB 4NWUL 4P3CL 3O11B 5EU3A 4R2GC 4HQQH 3A67H 3BDYH 4JRXB 4M6OH 4PY8J 3MCG1 3IT8D 4JPWL 4PG2A 1U8KA 5DZOA 2V6HA 3GIVA 4PJAF 4YFDB 5KBNC 1GIGL 3G04A 1KENH 4PJHF 1BF8A 1IEBB 5CJXC 4YUEH 3BAEH 4LGRB 1AC0A 4XP1L 4ZYKA 1T6WA 2DJSA 2VIRA 4XT1C 1MJ7L 2OK0L 2NLJB 1H3VA 3LAFA 4YHLL 4GAFB 1KXVC 5F9OH 3O0RH 5KTEH 4JB9H 1I9EA 4UIKH 2CDGB 4QRPA 3C60D 4I0CC 4Z7VF 3T3ME 1BJ8A 5B4MD 4BFBD 1I8MB 3S5LG 4HZAA 4RAHA 3DOSA 1VFAB 4HX1B 3RU8L 3GZKA 2E3VA 2MOVA 3RVUC 2PXYD 1PG7H 2ID5A 1GGCH 4XVSL 5A2JH 1NMBH 4YHKL 2RJMA 5I1KL 4CNIA 4I0KA 5DO2C 4GBXC 5KOMC 3TH3T 5DT1L 4PJHE 1U41A 4UIMA 5D96C 3IU3A 2DBJA 4PB0L 4HWZB 2KPNA 1EJOH 1LO0H 3L3IB 1AIFB 5E8OA 4BFIB 2L0DA 2X1OA 1FGNL 1ETZA 3OKOA 1YNLH 3I6LE 3LQZB 4JFEA 2NTFA 4G80B 1N2RB 3LSOA 4ZFZA 3FCTA 1FZJB 2A6KA 4NKIH 2IBBA 2PTUA 5C9KA 3QHFL 3T0EB 1ZT4B 4PJ5A 4GAYB 1BEYL 5KTEL 5CUSH 1ZT4A 2FJHA 5E6IB 3NCJL 1P1ZB 3PHOA 4PJDB 4TVPD 1BP3B 1FCCA 2HLAA 2FB4L 3KDMA 4XNMA 4K7FA 5E2WL 3OKOB 4F7MA 4QHMA 3AY4A 4AIZA 5H94A 3L3IA 2FBJL 1AGBA 4FQ1H 2B1HL 4J3UA 5I0ZA 1FDLH 1TJIH 1YEHH 5F7EL 2DWDA 4DGYL 3PHSA 1EK3A 4HH9A 3PIQB 2VDNH 2YPLB 3RIFF 2X5PA 4NKMB 5ID0A 2D7NA 5AAWA 5E2WH 4PD4J 5GRJH 1MHCA 4PR5A 4G6MH 3SJVB 2FL5A 4J3OC 1YECH 2XV6B 2Q8AL 1OSPH 1CT8B 4I18C 2E9BA 5DJ2B 3CDYA 1ITCA 3WD5H 2FEEL 5F6HI 3QRFM 3CFKB 3FO1A 3C5ZC 2VIRB 43CAA 2BNUA 1G6VK 2BNRE 4NC0B 4RFNC 1QPPA 4S1DC 5I1GL 5DSCA 4HKJB 4MCYA 3LHPL 4GKZB 4PY7B 1N3NA 5H37G 4PRAA 5GPRA 5DD0H 1Q72H 4TTGA 2BDNL 4JKPH 1QUNA 2R0LH 1M71B 5CILL 2OQJA 4RZCB 1MRCL 5SWZD 3O11A 5EU3B 3ZSSA 1U3HD 4Z7WA 4KC3B 5HYSB 4OUOA 1KJ3L 5IW3A 4CVWA 5DMGC 1EHLL 1NEZA 4AEIL 2DQJH 4PRDB 3HA0A 3FRPG 1NQBA 1HCFX 1F97A 4LLAA 4IRJD 1A6ZA 4GQ9L 3RBGA 1CXHA 3O2WH 4Y19E 5HTSA 4AEHH 5F9WC 2PYEB 3WE6B 4ZUSB 4U6XA 2M1KA 1L0YA 4TNVF 3CK0L 3KPTA 3ARDD 1L7IH 1A6UH 3CUPB 4PP2A 2CQVA 1OL0A 5TE6L 4XNQB 1BVKB 4WI9A 4RX4D 5D2NE 4YXKL 2AGJL 3EJYD 7FABH 3HB3C 3QIWC 1T7XA 1XGQB 4ZS6C 2KZ1B 4BKLB 1JPGA 4XBEL 3D25B 3I2CH 2X9YA 4RQQB 3HG1A 3HPJB 3MCKA 2GHWB 3V4PL 4KJPC 4M1CD 4CGTA 3QIBB 3CVIL 3V0VA 1CWVA 4OFVA 3GSXB 4BQBA 4LCUA 3QFJD 5GSVB 4PFEA 2XZAH 2OZ4L 1MELA 1U2HA 3LQAH 5SWSA 4GAJH 4P46B 3DUUA 4ALAL 1YQVH 3QXVA 3BWUC 5DJ2A 1P4LB 2H2PC 4NDMA 1NGZA 4Z76B 3DJ9A 1FZOB 3FQRB 1BZ7B 3SGEI 1TZHA 3S4SG 5IMLB 43C9B 3U2SA 3OTTA 3Q1SL 3WFDH 1JI2A 1N4XL 1ZVHA 5CJXA 2YPLA 3V52H 5E5RB 3O2VH 3VI3E 2F8OA 3QCVH 4GKNB 4LLQA 1ZHKA 3HE6B 3HI1A 1RIUL 4HLJA 4FNLL 2DL9A 4ZSOE 5GGTA 4YHNA 3MLVH 3MZTA 1JPFB 1KIRA 3G5ZA 4UU9A 1JZ6A 2RFXB 4NQEB 1HHJA 4ZO6A 2RCSL 3G08B 1MOEA 1SYVA 4O00A 2DYPB 3TBTB 2GFBB 3HC0A 1OCWL 1RZGB 4XPHL 4UUJA 1MCEA 5D2LF 4ODVL 2LTQC 1HQRA 2ZUYA 3V0AC 3P77A 5KSAC 2MHAB 4C57C 4OQTH 2Q20A 2HAZA 4XHJD 4JY5H 3OKNB 5IFHH 3FOLB 3S4SA 5HYJD 5I1JL 5ANMA 3WN5A 2UZIH 2DTSA 4Z7UE 4OLZL 1MJJB 3MNZA 4N8PA 3DVIA 4MYWB 2F53D 5K9JH 1CU4H 3BKML 2ARJQ 4JR9L 3QEQE 3HI6H 4NZDA 5E8OB 2EDKA 4BFIA 4LPXA 3O45A 2V2WA 3WXVH 3HCVB 4M7ZB 4CDGC 5IEKB 3O2DL 4HAGA 3VMPA 2B1HH 3DYPA 5HHMD 2X4OB 4R2GD 1ZLVK 4JZNA 5L8LB 4PJGB 5BVJB 1DDHA 4CW1A 4I2XE 5IUSA 4NQDB 3T0ED 1H3UA 4HZLB 5I73B 3WO3B 3U79A 4TOYL 1PFCA 1MVUB 3VFUA 1KN2L 1VFBA 4QHUA 1BWWA 4GXVH 3DPBA 2D7OA 3P2TA 4NT6B 3LKNB 1FIGH 3QIBC 1Q9LA 4PRHB 4NQED 1KJ2B 4X7TA 2P8MA 4YZFE 1LNUA 1FO0L 1FAIL 1CI5A 3O6FD 4IDJL 5HHOB 4LRNL 3T65A 2I24N 1FRGH 3OPZL 1TCRB 5B4MC 2FR4B 4KK6C 3DHJA 3V6FB 3VE0A 1U8KB 3ARBC 1NMBL 4YHKH 3UTSD 5CEZE 4YHZH 2W9LA 4EI5D 3KPSB 3UAJC 3Q48A 4WI7A 4UQ3A 1A1NB 1F90H 1P9MA 4U0RB 1WBZA 3EFDH 3IDNB 1OGTA 1UM6H 3F12B 4XRCB 1FNFA 3IDJA 3QIUD 3QNXA 4PJ7E 3X11A 1BQSA 4NKOB 5D1ZA 3B6SB 3OJVC 5T3XL 1H3PL 3T1WA 1MFBL 2A6DB 4L3EE 1XF4B 3UZVB 2X4NA 4IOIA 1YEDA 3RAJL 3WUWA 4ZS7L 4EVNA 3CSPA 2HVJA 5DJCB 4IJ3B 4HFUH 3C6SA 4Y19A 2DLGA 2E7MA 3UX9B 5L88H 1U36A 3IXAB 3VWKA 5EFIB 4RBPK 1GH7A 3QWOB 5GJSL 2X89D 4JFXA 4LRIC 3LKQB 2MQ3A 3QQ9C 4PJ9A 3VXPB 4P3WA 3DBXA 2Z35B 3HLAA 5TJWK 5DJ6A 2D7TH 2ARJA 1I7RA 5JQ6L 4OM0H 1M7XA 3O3EA 2P5WB 3PWLB 4DCQB 2Y36L 2VN4A 3IGAB 1Q0XH 4JO1H 1WIOA 1S9VA 5CKGA 2PW2B 3EGSB 3E8UL 5ID1B 1AP2B 3NCYS 1RUML 4X6DA 3ALXA 1TTGA 1OAUL 1ZHBB 4L1DA 4LHQB 3RGVD 5ALBH 3UTZB 1Y6NR 4I5BA 4YBLC 1XR8A 4QXTB 2D7PA 4IRZH 4GW5A 3IDUA 2V5RA 2NW2A 1INQA 3LHPH 4XPTH 5EH1A 1SMOA 1WWAX 5F3BB 2DQEH 3DGGA 4G7VL 3EYOB 3REWA 3NBNA 1MLCB 4LLVA 1J0KA 4MNQA 3B2VL 1BFOB 5FA4B 5KJRL 3UXFA 1NFDE 3O6KH 5AG9A 2OCFD 3KPOB 3MJ9H 4QOKD 3V7AG 3VGHA 4I18B 3BZFB 2IQAB 1MI5B 3AU1A 2EIEA 2Z0BA 4J12A 1OTTC 3NIDF 1NGYB 1F5WA 3OKLA 3QZWG 3QNYA 4LCWB 5C71A 4B0MM 4YJZL 5I19H 4GXUM 4ODXA 2VXQH 3KWWB 5DJDB 5GGSY 4PRPD 1OOAA 5HGGS 3S36L 1JRHI 1AD9B 1KNOA 3SDDA 1QHPA 2FIRT 2LAGB 3BP7B 1VPOH 1UA6H 4S2SB 1JFQL 2EEDA 1CLZL 4LPUA 3KPRB 3WL9A 1MCPH 1UENA 4DUXA 1IC1A 4U05A 3SE3C 4P0DA 4KAQH 1IAKB 2FDBP 1E4XL 4FFZH 4OZIA 4JKLA 2VXUH 3KPLB 5CCKH 1NMCB 3BZ4B 2GY5A 3PWJB 4PRPA 2O5YH 3IVKA 5BJTA 2FGWH 4NM8L 4OIIH 3T2OA 4OZGF 2ADGB 1G7QB 1R5IA 5CGYC 3D18A 4BH7B 5F88A 5GGUA 3NOIA 5ETUA 4CJ1A 4Z7UB 5E24E 4Q2ZA 1MH5B 1WFTA 5F1KC 2VXTH 4FQLL 4N0UB 2IGFH 4HKBB 4UMGA 4NUGH 3HI5H 5JR1L 3HZYB 3BEWB 4JHAL 1KEGL 3PWUB 3I6GB 1CXEA 3MOBH 3EYFA 3MLTB 4NRXB 1FJ1A 1ZAGA 3Q6FA 3Q6GH 4XXCC 3GSVB 1TVBB 3WYRA 1J1XH 1G7MA 1HHKA 4WO4D 1IGIH 5ISZE 1KTKE 4ZO8A 3FAXA 5K93A 3MGTB 3SKOA 5KS9F 3QIUB 3L7FB 2MPAH 4MA7L 4HGWA 3QULA 5E5UB 3RHWF 4PBXA 1D7FA 1ZLSL 4XP9L 3W82A 3TVMA 3SGJC 3K81A 4CVXB 1OWRM 1J18A 2Q7YB 5CP7B 3QQ9D 4JLRB 2X2YA 2B0SL 2FEDC 3LN5B 1DBJL 4X6FB 2H32B 3ECBA 3QUYC 4V2CB 5J1TC 4G8FA 2X4RA 4XMLH 1RK1A 3CSGA 2PCPB 3QO0B 4UQ2B 4UDUA 5MEND 3VFMB 3ARBA 4HLZH 4L9LC 5LBSH 2EKJA 5C0IA 1TTUA 3V4UH 4KU1A 3V79C 3A67L 4M6OL 3L9RA 5DHVH 4D9LL 4Q6YA 1UACL 2FWOB 3U0PA 3WJJC 2FGZA 1P9MC 2HJKA 3TNNB 3HE7D 3HZMA 1GOFA 1C12A 1SJEB 3S3PA 3PGFL 1TVDA 4LQFH 1W0WA 2A73A 1QO3B 5DYOB 1HZHL 4PGEB 4X5WA 1BHGA 4NZRH 5C0RL 3HNVH 4Q58C 1Z5LB 5EIIB 3UYPA 4HWBA 3ZMRA 2DD8H 3MXWH 4FFVC 4X6CF 4GRMA 4R8WL 1I7TB 4K3GA 3ZYJA 2JJSC 3D2UA 1DE4B 1F13A 1JN6B 3U9PH 1D9KC 1N59B 5IESH 1DSFL 4DN3H 4F37K 2FO4B 3FRPA 4HJ0C 1W8OA 5DVOA 2DQUL 5TGBA 1NCBH 3WFHB 5GGQH 2HVKA 4WHYH 3WLWC 1F8TH 5JHDE 3UC0L 3NZ8A 4UOJA 2PO6D 1JI1A 1QVOB 3EYVB 4G6JH 1L0XA 4D0BA 4Z9KB 2QQLH 4PJ5D 3K4AA 1I9IL 3DSFL 5DA0B 4U49A 5TH2B 5JPNA 3P30H 3OAYH 3I75A 4MAYB 5TE4H 5MEOB 1REIA 4G5ZL 1XGRB 3ALPA 3V5KA 4ODHH 4P2QA 1BVLB 3IRPX 4Z78B 1WTGT 2VZVA 3GSRB 5C08B 3MRKA 2YUXA 3TWCL 1XAUA 3WEXB 5BOPA 4BELD 4JDVA 5C09D 5IFAH 1IAIM 5F1NA 2DRUA 4NNPL 5F7DA 5C09E 5JOPD 2BY0A 1XIWC 3MLPA 4FS0A 4P2OA 5CEYB 1PVHA 5ACZB 5DI8A 1ZT1A 5BXFB 1UYWH 3JZ7A 4JPWH 1VADA 3TPUA 1RJYB 4F9LA 3SDYH 1JWSA 4QRRB 1R0AH 3OR6A 1CGTA 3KJ4C 1R5WA 3B3IA 1OTUC 3MRGB 3B3IB 4HC1H 4LFHD 4X6DF 3PWVA 5DK0A 4YXLH 4YEFA 2Y5EA 2ZG2A 1E4WH 4YHML 3DECA 2OR9H 1KPVB 4JM2C 4LSPH 4S1RL 2XNAB 4DKAA 3FT3A 2CK2A 4OFPA 5DMIH 2IC2A 3LKPB 5ACZA 3AXLB 1UXSA 4R0LB 4KKAD 4LCCC 3QQNA 1F2QA 5HYEA 1G7PA 1O0VA 4YWGH 4O2FA 4N5UA 3RNKA 1QYGH 4LPYA 1DVFB 4R4FL 4KHXH 3QZWB 5T1LD 3OSKA 3DX6B 1TQBC 4O9HH 4P2RB 4N0RA 5F1SA 1BAFL 4LHUD 4TSCL 1WCBB 3GKWL 3TO4C 1MFDL 4LSSL 5HVFB 5HHNA 1JPTH 2X09A 2PTTB 4IRJB 3IRZA 2EH7H 1RJLB 1S7XB 2I26N 5IVXA 4WI3A 3QQ4A 2J5LC 1H5BB 4GW4B 5I15H 4WWKB 2DIBA 3MLZH 4MS8D 4KHTH 3BJLA 3O2DH 3DV4A 1NKRA 2G2RB 2UZYB 1M4KA 3IDXH 3K0WA 4YBLB 3WXWL 4DVBB 5DD6A 2DLIA 5HYJE 3QUYD 2PF6A 3HI6L 1EA9C 5BV7B 1WK0A 4M3JA 1DE4A 1D6VH 2B0SH 3QUKB 2E7LC 2HFEB 4OZFH 1OVZA 5HGHB 3O8XB 4GRMB 1BFSA 2BNRD 3BH9B 5E7FA 4KKLC 2JCCB 4HIHA 3EO0A 4MA3B 5C6TL 4OF5A 3LZFL 4NP4L 5D7SH 5SWSD 4GG6E 3MC0A 4G9FE 3STBA 4X5WB 1IT9H 4JQXC 3QISA 4XI5D 1EEYB 1LEKB 3CLEH 1JHTA 3ES6A 3RTQB 1EEYA 4FXGA 5GZOC 4OFKA 2A9NH 2VH5H 1MY5A 2DF3A 2CIKA 3KXFE 2C9AA 3EFFB 4OCWH 5DMJB 3DYMA 1MFEL 2GK0B 3H9SD 3B8YA 3QEQA 5EO0A 3HFMH 1IGTB 2V7NB 4F37F 2A1WH 4B7LA 5LWYH 3IDMB 4PJXF 5HGBB 4ZTOL 4L9LA 25C8L 1Q0YL 1CFVH 1RIHL 3ZDYE 3K4DA 4DKDC 1CD0A 3QUKA 2MKWA 2X4RB 1QFWI 2JIXB 4LKXA 2X9XA 4XWOC 2Z9TA 5IV2B 3LN5A 2GIYA 3L5XH 2VLJB 2WBWB 5I1DB 2HA1A 2NR6C 5AD0B 4HK3N 3N06B 3JUYA 5CP7A 5A2IH 3OKKB 2GAZB 2ICCA 2R2HB 2G2RA 5FDWA 2EKSB 3VXSD 3AS1A 4PY8I 3MYJA 2BOCA 3QDAA 1IAOB 1A22B 1QNZL 2J8UE 1YN7A 5FGRA 1B0RA 2O5ZH 1HSBB 5EO9A 3MGTA 1SY6H 3HN3A 1IAMA 5B8CC 1FL5A 4NRZB 4NFBA 3N1QC 5DRWB 1D9KA 1CG9B 1EX0A 5HDOA 4Z0BL 3OG6B 3C60B 4MJ2A 4WU7B 5J0BA 2K7QA 5MP6L 1B4JH 5EORL 5IIEB 3E1F1 1YEIH 2BY2A 4FQJH 2A0LC 4KMLB 1PW3A 1G9NH 4WENB 5HI4C 2WNGA 3QI9A 1QP1A 2JELH 1GAFH 5TE6H 2W9DL 1G7PB 1IKNC 4X0KA 3PL6B 4R0LA 5CIPB 1K4CB 3B2UD 3SO3B 1S7UA 2P5EB 1EAPA 3BE1H 4QGTA 4GQ9H 3WDJA 5JZ7C 2K3TA 4FQIL 3U1SH 1KPVA 2W9EH 4FQ2H 1X7QA 3HR5B 3L95B 5E56A 1GGIH 3MRHB 1JTOA 4MNHB 4QRUB 2LTQB 1T2XA 4HXAL 1FO0B 3U82B 2D2OA 3MA9H 5C0BE 4EIGB 4DFHA 4UT7L 2DQCH 2DQEL 2ZUXA 1Q94B 4GRLC 3RWFB 5D70H 3I02B 3AMLA 3IDYC 5DZLA 3GUTB 1KPRB 1WUNT 3D39A 4OD1L 1J0HA 5DI8B 4QWWC 1DLHA 4N8VB 3IAGC 2HMIC 1C5CH 1W72L 2H2SC 3ULVE 1CQYA 3HE6C 4FFYL 4ZUVB 5BZDA 1B90A 1VSCA 4HULB 1AD9A 4P59L 3RA7H 4I3RH 3NIFE 1GOHA 4JG1H 2DD8L 3MXWL 5DJ0B 5IBLC 4PLKC 3V5HA 4PJXA 3WNPA 2EYTA 3VFTB 3UYRL 2C4FU 2NXZD 3IDGA 1T83A 4WGWB 3G6JA 2J4WH 1PEWA 1WZKA 3KPOA 1II4E 3MZGB 2YPVH 1UM4H 4K9EC 3VXNA 5GS0D 3PL6C 5FF6A 5HHQB 3LEXA 4LNRA 1B88A 2FLBT 4QXTA 3LN9A 1R24B 1WQVT 4FQJL 1MFNA 2CR6A 4LCYB 5TDOB 7CGTA 2R56H 1FAKT 4LDLB 3M17A 3R4DA 1UJ3A 5DTFB 4MA8H 3GMNB 1I7UA 2VAAA 2VLLB 3VWKD 5HPMB 1FL3A 3ULVF 3HMXL 5H35A 3U9UA 2VDPL 5CJOH 3D2UB 4JREB 3RVXD 4JY4A 1A9EB 5D7LD 4IOFD 1WISA 4LPVA 3BUYB 2Z8VC 3CK0H 4Y1AB 4P46C 4HS3A 4X4MA 4JZOB 2V7HA 3E6HA 4OKVB 5HGDA 4PYHA 4R90H 3MV7A 2GT9A 3VXPA 3FHAA 2EE3A 2AJVH 3VGBA 3P4OA 3M1BA 1EHLH 1G7IB 2VJXA 3QWOA 1Q9OB 4KJYA 4NCC2 1TCMA 3ZYZA 1I3RB 4HHAA 5B21A 2GUOA 4M6AA 5JNYA 5IT2L 2VXVH 2E7LA 4JHAH 5ESAA 3WDIA 3HNTL 5I30L 2ADIA 4BA8A 3VCLA 1YDPA 1LEGA 1RK1B 4UQ2A 3KGRA 3FHQA 1NDMA 1ZV5A 12E8L 2JB6B 3ME0A 1FL6B 2X9WA 3EO9L 4TSAL 2UZXB 3VA6A 1YZZA 3TLRA 1ZGLM 3SDAA 5CWSA 4AQ1B 5C0GA 4HXBL 2QKIB 3V95A 2N1KA 1A2YA 3HE7A 1AR1D 3KS0J 3H0TA 2DM7A 3GM8A 3DXAD 3RJQB 4IMLA 3LIZL 5AEAA 3LRHA 5IB4B 4FFZL 5I8CB 1MCBA 4OZHF 3QUMH 4ZOAA 4Z95H 3ARXA 1NMAH 4EKXA 3CX5J 3GB7A 3UTSB 3SDDD 1UWXK 1QSFD 4Z7NE 5HHOA 1CE1H 1FLRH 1QSEE 3A6BH 3BOVA 4PG2C 5E00A 4NRXA 4PJFF 5JORA 1CIUA 1T3FA 4XAKD 3AROA 4D8PB 3BDYL 1FDLL 2D9CA 3UTQA 4Y2DC 3EHBC 4KQ4L 2NY1D 4JFQB 4GRWE 4NWUH 3I6KB 5IQ9B 1IC4H 1QQDB 3MV9A 3CFIC 4OCLC 1SEQH 3GGWB 2XQBL 3AREB 4C56A 1MH5A 4JFDA 4OZIF 2VLJE 4W6XB 3VXUB 1N6QH 5EBGA 2ICWI 5CSZA 3P4NB 4GSDL 4H88L 2XWTA 1KCVH 3JWOH 4BFGA 5AYUH 3MRLA 1BQHG 1TJHH 5IEKA 1JGDA 4PJCB 5EB9A 3AGVA 4I2XA 4Y4FD 4NBYB 4YDIH 1YY8A 1T7VA 1LK3L 1MAML 3KLHC 1FHGA 5DUML 2BSTB 2ZCLH 5KSVA 3L3HB 4KJWC 2D3VA 4MLSA 5BZWB 1DEEA 1A8JH 4JFDD 1DVFD 1KEGH 3PP4L 2YD1A 1NBYA 5CLWA 4X99B 3SDXE 3HI5L 3MA7B 5JLZB 2CKBB 5FCUH 5EO1B 5IQ7H 1RPQA 3D87B 2WINB 1AD0A 2YHGA 2VXTL 4PGCB 1Q0XL 1G0YR 4OD2B 2Y36H 3VFPB 4Q74A 5FGBC 4EN3D 2XIDA 5DJDA 3TBYB 1Z6JT 4MJ6A 3F5WB 3V8CA 1G0DA 2KH2B 3RI5K 4GRLA 4H26A 3VFPA 4EBQL 3O0RL 5D1QD 4MXQD 4H1LB 3HAEH 1IBGH 3TM6A 3BHBB 4WUKH 5IB1A 5FA4A 3SKNA 1OD9A 1YJDH 3MROA 1FZMB 3DGGB 3QXTA 5FB8B 2DLFL 4I4WA 1BFVH 5MENA 1FGVL 4GW5B 1XR8B 5KSVB 2XKNB 1TVHA 1MCWM 4TQEH 2CRZA 1DQJA 2XICA 3IU4H 2C3GA 1XGUB 1HNGA 2ZPKL 2OL3H 4ELMA 3OL2A 2HFFB 4NQCA 2QQNL 3D48R 4E9LA 4P3CH 3T3PE 3MLYL 4Y5XB 3BD5A 1S9VB 3RP1A 6FABH 4OI8A 3LY6A 3QUZD 4P46D 4Z5RA 3ZE1F 3L3KA 3QUXA 3VFVA 5IROA 4QWWD 5TPWH 3D85D 4ZPVA 1NCBL 1KJMA 2G60H 2CKBL 5EOQL 4FZ8L 3VFVB 2NXZB 4OCMC 5DFVC 1DBAL 4LPTA 2IF7A 3U9PL 2D4DA 3QDJA 5I9QC 2Z91A 3WKMH 3C5SA 2F58L 3UTOA 5DJCA 3FJTA 3LVEA 4XNQA 1UB6B 3MV8A 1BQUA 2C3HA 1QKZH 4PP2B 2EE9A 2CLRA 3T8XB 2A6DA 4OF6A 3UTSA 2E8YA 1DFBH 2HFFA 1PDKA 2IALA 1PQZA 4NQCB 1LP9E 1NCNA 5ERWA 4ZAKA 1RZIB 4JQVA 5GRUL 3U7AA 1OAQL 4X5LA 3O81A 1FFOB 3K1DA 3G6DH 2Y23A 5IHBA 1SVZA 4OM0L 1NFDF 1WZ1L 4ZD3H 3DIFB 4UQ3B 1OAYH 3QA3A 2OLDA 4KK8D 2AJUH 2ITDB 1MPAH 3NN8B 2BVYA 2K1MA 4MCZB 4RAUA 2LE9A 3FFCE 2HTKC 3A6BL 1ADQH 4HWBH 4WFFD 3OZ9H 1N3NB 3PGDA 4PJ9C 1VDGA 1A9BA 4MJ6B 2IQ9L 4GKZA 2FJFA 1OP3K 3BGFB 5KW9L 2AW2A 3HAEG 2Q7NA 3QUML 4E42B 2R0WH 4HPOL 1P6FA 2HFTA 4CMHB 4NN6B 1JGEB 4MQSB 4PJHB 2XACC 1U42A 5C0EA 2ENSA 4OF3A 3U0TA 3VGGA 1Z3GL 3D9AH 1M6OA 1X5AA 2A77L 2F8VA 2XZCH 4MB3A 4RWHA 5K33A 1LILA 1AO7B 4WJ5B 1OTSC 1YY8B 4XBPB 4PJCE 1WITA 5D5MA 4KI5C 5TE7L 4OD3L 1UZ6E 5DUPH 4YHZL 4JZNB 3ZT7A 2Z93A 5CLTA 3FB5A 1MHEB 2DWDB 2XQYG 1B3JA 3UO1L 1I75A 4R4ND 4QXGL 2YWZA 3G5YB 5KVDL 3V2AR 3KLHD 2C3XA 4ISVA 1I1CA 3MRIA 2P45B 5DEFA 3UP1A 5E08L 3BN9C 3I50L 4LVNC 3QG7H 1LQSR 4HJJH 1MCOL 4GAJL 1AXIB 3LQAL 4BUGA 1SMAA 2YD2A 4KVNL 3TA3A 2P43B 4I3GA 5D6CA 1MJ7H 2NTFB 2J6EL 4HPOH 2OXGA 1HHJB 5FEBA 1IEAA 1MCPL 4YNYB 4TYUA 4Z7OE 1S3KL 5ANME 4UIMB 4OLVH 3S6CA 4E41A 2QV2A 1HIMH 4QF1B 4EOWH 4HC1A 2HN7B 3DRQA 1BF2A 2JJVA 1JHLL 1X5LA 1KPUA 3SE4A 1QFWM 4NQTA 4JN1H 1PKQA 2BNRB 5K9JL 3JXAA 4HX1A 3ILPB 1ZA3A 5KSUB 4KUZL 4MD0A 4DJMA 5C92A 4WUUA 3PP3K 3NZHL 5HY9A 3CDCA 4KV5F 3OXRB 4Z8FH 1FZOA 3ZE2F 3IJYA 5EZJA 3RTQD 5KAQF 3VCLB 3OF6D 1DFBL 3V7AE 4G8IB 5JNYB 2DQGH 5E2JA 3STLA 5KVEH 1P84J 3RA7L 3RX5A 3UAJD 2IAMB 4QNPE 2WQRA 2IPKB 5I8EA 4QOKA 2VZ3A 4D9QD 5DQJB 5IW6A 2W0KA 1TTFA 5I74B 1F4YL 4MJIA 3C8KA 3D25A 4L8CA 5J1SC 5CFHA 1MCRA 4XCNB 1EMTL 3CSYB 3G6JE 2W0FB 2H9GA 1MIEH 3MUGA 2HMID 3T2PA 1PG7X 3IFNH 1GHFL 4GMSH 5D5ME 1RUAL 3O2DA 4ZNEE 3ULVD 1A9EA 3SCMB 1JWUB 4LARL 4KZEH 3CUPA 2EO9A 2H41A 1RZ7L 5M94B 3SGJA 2VZ1A 2C26A 4PJFE 1KUMA 1BD2B 4CBPA 3UPCA 5KOVC 5F7UA 4K7PL 4HT1H 5BRZB 5MEQB 4WV1A 4R3SB 1TZIB 1E0OB 4P2RD 5DC4B 4ZDHB 2JELL 2HH0H 4FFVD 3SKMB 4XC3L 4MD5A 1P6AB 4WW1A 5IG7B 3RAJH 5EORH 5JW5A 2W0FA 1WAAE 1JNHA 1MFBH 1GCFA 4PJXE 3STZB 5CMAA 1JMZA 2KQNA 5T3XH 1WZMA 3WHXB 2V7NA 3VWKC 4MQXC 1O7SA 1X4XA 5HHPA 3CFJA 1RFDL 2Z31D 2V17L 3HNSH 1CFTA 4U0RC 2BRQA 3FQUB 3SE9H 5C0NC 4UILL 3VFGL 2DQDL 4N8VA 5E08H 2ATPB 1D5XA 4HUVA 1ZLUK 1CN4A 4PRNB 2V2TB 3W9DB 3ZE0E 3T04D 2G9HA 1ORSA 1PLGH 3WCYA 1YMME 2ZKHH 4KDTA 2APVA 4F7EB 2VMFA 4POYA 4F9PA 1J0IA 3HUJA 3CIQA 3ROLB 3SY0B 5I0DA 3EJJX 3ULUL 4IBLT 4L4TB 2HN7A 3DRQB 4RGNC 3VXQA 4PJ8C 5DUPL 5I1HH 4XWOD 4OGAC 1KCVL 1A47A 2A9NL 2APXA 1LDPH 4HW6A 3MOAL 1NGQH 4NKDB 5DEZA 4X0KB 4GW4A 4PTTA 5ENWB 3FT4B 1VKXB 4OKDA 1U3JA 4G43B 2CSPA 4XNXH 2XQBH 4M1CC 5D7IB 1H3WM 3HS0B 3OHXA 3K1KC 4HF5H 3CPLA 1XGTA 2CDEB 4LU5H 2CUHA 4Z77A 4LP4A 3WHE0 5HHNB 4MDJB 5FK9B 1QFWL 3RNQA 4JGMA 3JV0A 3MV01 5AWNH 1RVFH 1Q1JH 3SDDC 4OSUH 2GW5A 1MWAA 1QSVA 2AV1B 4ONGH 3WUZA 1S7TA 5D1XC 4OQTA 4XAWL 5I18L 4PREA 4CNIB 2ICEB 3RY5A 5IB5A 4JFZL 4XTRC 1GGYA 4FQ1L 2OP4H 3FZUC 1LDSA 1TNNA 5FDWB 3EYUH 3OAUH 2G5RA 1AO7A 4XBPA 5DK2A 1YPZB 4NCDA 1KG0B 4JM2A 1KIPA 3CFEA 1JIBA 4LGSB 4POUB 3HMWH 5JQHC 1U8LB 1YN6B 5DO2D 3NCJH 5IB3A 5C07D 1R5WB 1ITBB 2YZ8A 2G75A 2QR0B 1KIQA 5JHLL 5E2TL 4ZUWA 4EN3A 4L8DA 2VDQH 2YBRB 1XH3A 3WIHL 3N85L 1YEJL 4FXGB 2QADC 2OMNA 4HF5L 4LLDB 5DJYA 3UTTA 3ZE2E 3RZCD 9CGTA 4H20L 4FXKB 3E3QE 3O8XA 3V5KB 2WBKA 1RZKC 4E41E 2YPKA 1S9KC 5IFJA 2HFEA 1W0YT 2FZ3A 3LCYA 1T03L 1ODAA 4DQOL 5A3ID 1J0JA 1MNUH 3BKYL 4XMKH 1AGEA 3WNNA 5DD6B 3RGVC 4YHLH 1ZKAA 1N6UA 1YNTA 3TVMC 4OGXH 5D7LE 3BFOA 5EUOF 1DL7H 3Q5YA 3KXFD 5I1EL 1MREH 5M7QA 5IFAL 2DMCA 1DBBL 1YPZE 3FQNA 1ED3B 5HHOE 1YYLH 2MCG1 4IRJA 3TJEL 4EJ1C 5JHDB 3D85A 3ULUD 3NGBC 4UB0H 1UM4L 2OTUB 3CX5K 5F1IB 1ZS8B 4KUCD 2BCKA 5F93C 4RWYH 1RFDH 4K94C 4GAGH 3MODL 1YEFL 1LO2H 5FYLH 2BOBB 2W38A 3MV9E 3ZHDA 1Z5LA 3ZKND 4AMKH 1WEJH 5J11B 3RNKB 3MFFB 4OLUH 4V1DE 4LHJB 4O2FB 4Y5XA 5HJ3A 4RRPA 1W0WB 2IJ0C 1ACZA 3VFNA 1UT9A 2H32H 1WTLA 2VKXA 1KFAL 1OGAD 3D2UD 1M7DB 3HG1D 3OMZA 3QCUH 2JK5B 3R0NA 5CD5D 1JPSH 1N5AB 1QHOA 3BWAB 5GRWA 4MQ7A 4DTGL 3TZVA 1KCRH 4RGMC 4DZBB 1U3HB 4G8FB 1CE6B 3LEYH 3MROB 4I9WD 3MRJA 4JQIL 4NIKB 4PP1D 3SKNB 4R96B 5KSBA 2VC2H 1KGCD 4WFHE 2ZUTA 4L8SB 2DN7A 3S5LB 4H1LA 1OSPL 4NZRL 3T4AA 1AXTH 4P2OB 4XWGL 4YFLI 2D03L 4KGJA 4XAKE 3TNMA 2AEPH 4HDIB 5FYJU 4OD2A 4OGZA 4WHYG 2Z31B 2XN9D 3QDGE 1I1AC 3MA7A 3HAEB 4IMKC 4DGYH 4ZNCD 4RDQG 1Q9KA 4TSBL 4P2QB 1T20A 3QI9C 4PTUB 4F7TA 3X3GH 3DX7B