6FAOA

Discovery and characterization of a thermostable gh6 endoglucanase from a compost metagenome
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
288
structure length
286
Chain Sequence
DSAFYVDPDTGAARWVAANPGDPRAAVIRDRIASVPQGRWFTQNNPGTVRGQVDAFVGAAAAAGKIPILVVYNIPNRDCSGAGGMPNHTAYRQWIDEVAAGLAGRPAAIILEPDVLALMTSCMNESQQAETRASMAYAGKRLKAGSSQAKVYFDAGHSAWLAPSEMAARLVAADIANSADGISVNVSNYRTTAESVNYAKAVVAATGAPHLKIVVDTSRNGNGPAPDSEWCDPPGRAIGTPSTTDTGDPAVDAFLWIKLPGEADGCIAPAGQFVPQRAYELAIAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Glycoside hydrolase family 6
publication title Discovery and characterization of a thermostable two-domain GH6 endoglucanase from a compost metagenome.
pubmed doi rcsb
source organism Metagenome
total genus 107
structure length 286
sequence length 288
ec nomenclature ec 3.2.1.4: Cellulase.
pdb deposition date 2017-12-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...