6FGSA

Solution structure of p300taz2-p73ta1
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
130
structure length
130
Chain Sequence
ATQSPGDSRRLSIQRAIQSLVHAAQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALAAYHAKHCQENKCPVPFCLNIKQKGGSGGGTGGGSGTIEGRGDGGTTFEHLWSSLEPDSTYFDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antitumor protein
molecule keywords Histone acetyltransferase p300,Tumor protein p73
publication title Regulation of the Activity in the p53 Family Depends on the Organization of the Transactivation Domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 30
structure length 130
sequence length 130
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2018-01-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02135 zf-TAZ TAZ zinc finger
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...