6FT65

Structure of the nop53 pre-60s particle bound to the exosome nuclear cofactors
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
73
structure length
73
Chain Sequence
TSWELKKQKRLEDKQFKERLKALKDEKEEARQAKITMLKERREKKEENERYERLAAKMHAKKVERMRRREKRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna
molecule keywords 7S ribosomal RNA
publication title Structure of the nuclear exosome captured on a maturing preribosome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae (strain atcc 204508 / s288c)
total genus 26
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2018-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
5 PF03879 Cgr1 Cgr1 family
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...