6FTHA

Hmo binding abc-transporter associated solute binding protein, blon_2347 from bifidobacterium longum infantis atcc 15697
Total Genus 185
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
185
sequence length
496
structure length
496
Chain Sequence
DGKPIVSVLVVKRPATDKIANMQWAKDLEADCDCKIEWQEVSEDAWAQQKNATLAAGKIADVSLHAFFPANAAQFPGLFEDLSKDLDKMPNVKQFFKEKPDAQKLTTDPEGHMYALPSSRGKSYSGTGQHMFINKTWLDKLGLQVPTTWDELENVLKAFKTEDPNGNGQADEIPMNIRKLDSYFTYYSPMLLLNSTGIVTGFNKGASPTGFYAKNGVVKSFLTSDEYKQVIKYYHKLISEGLIPADWATKTFDACDTDQLSDGKTAKTGVSFGWSQDASFGTLKDQYIPIPVPSAPGVSPDKTVWDGSSAEFEADRFSLSSHAANKDAALKLANLLYSEKYSVQQFLGSFGNLVTDDGNRHYTVDEDKYTKAMGDNLFPGLADRFSGWIPDGVTIKGDVDGDNLLEANKPYEEQRSHFDPVKDYIPDYVNPDPTDSNTLTNNNAQISNVVMQKTATWMSKGGIDEEWDAYCKQLDSLGLQENVKIWQKWYDIYTKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords Extracellular solute-binding protein, family 1
publication title HMO binding ABC-transporter associated Solute Binding Protein, Blon_2347 From Bifidobacterium longum infantis ATCC 15697
rcsb
source organism Bifidobacterium longum subsp. infantis (strain atcc 15697 / dsm 20088 / jcm 1222
total genus 185
structure length 496
sequence length 496
ec nomenclature
pdb deposition date 2018-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...