6GARA

Crystal structure of oxidised ferredoxin/flavodoxin nadp+ oxidoreductase 1 (fnr1) from bacillus cereus
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
346
structure length
346
Chain Sequence
EELFDVTVIGGGPAGLYSAFYSGLREMRTKIIEFHPHLGGKIHVYPEKMIWDVGGLLPVTGDKLIEQLVQQGLTFKPEVVLDTKVESIIRNQDGTFTLKTSTGEEHFSKTVIVATGSGILKPQKLSIEGAERFEVSNLNYTVKSLKRFKGKTVIISGGGNSAVDWANELEPIAKKVYVTYRKEELSGHEAQVKQLMNSSAECFFNTSITKLIAGDNHEAIEYVELTNHETGEVSHLPIDEVIINHGYERDITLLENSELDVAIIDNYYIAGNANSESSVDGLYAAGDILKHEGKLHLIAGAFQDAGNAVNKAKQFIQPDASEYGMVSSHNEVFKKRNRELIKQMMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ferredoxin--NADP reductase
publication title The Characterization of Different Flavodoxin Reductase-Flavodoxin (FNR-Fld) Interactions Reveals an Efficient FNR-Fld Redox Pair and Identifies a Novel FNR Subclass.
pubmed doi rcsb
source organism Bacillus cereus (strain atcc 14579 / dsm 31 / jcm 2152 / nbrc 15305 / ncimb 9373
total genus 102
structure length 346
sequence length 346
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2018-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...