6H5BB

Small gtpase in complex with its gap
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
VMYEEEFTKINAVCDRLTKDANAKVVFLVDKNGQLISSAGQTQNIDTTSLASLTAGNVAAMGGLAKLIGENEFPNQFHEGAKDSLYMTIVGSRVVLVVIFDNRTSLGLVRLRIKKASDELTKIFESLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytosolic protein
molecule keywords Mutual gliding-motility protein MglA
publication title MglA functions as a three-state GTPase to control movement reversals of Myxococcus xanthus
doi rcsb
source organism Myxococcus xanthus dk 1622
total genus 36
structure length 129
sequence length 129
chains with identical sequence C
ec nomenclature
pdb deposition date 2018-07-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...