6H6MA

Cr10 murine norovirus protruding domain in complex with the cd300lf receptor and glycochenodeoxycholate (gcdca)
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
303
structure length
303
Chain Sequence
RMVDLPVLQPRLCTHARWPAPIYGLLVDPSLPSNPQWQNGRVHVDGTLLGTTPVSGSWVSCFAAEAAYEFQSGTGEVATFTLIEQDGSAYVPGDRAAPLGYPDFSGQLEIEVQTETTKTGDKLKVTTFEMILGPTTNVDQAPYQGRVYASLTAVASLDLVDGRVRAVPRSIYGFQDVIPEYNDGLLVPLAPPIGPFLPGEVLLRFRTYMRQLDTADAAAEAIDCALPQEFISWFASNAFTVQSDALLLRYRNTLTGQLLFECKLYSEGYIALSYSGSGPLTFPTDGFFEVVSWVPRLFQLASV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein
publication title Crystal structures of murine norovirus protruding domain with conjugated bile acid reveal a novel binding pocket.
rcsb
source organism Murine norovirus gv/cr10/2005/usa
total genus 68
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-07-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...