6H8K2

Crystal structure of a variant (q133c in psst) of yarrowia lipolytica complex i
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
434
structure length
434
Chain Sequence
MLILAIISLITFVSMSKLSDNRAIIRLINIYLILVLVLDSFLYLLFLNNQTYTVMGELLIFNSFTFYIDMLIYFIMIVISSLYGXXXXXXXXXXXXXXXXXXXXXXXSNDFITLFVAIELQSYSIYLITAIYNSSYKASKASMLYFFMGGILSILIAYSINTYYSVLNSYTLHSLDSLIINTLDLNLILIALSLGLLFKIGIAPLHKWLISIYENTPILITIYISLIPKISILSYLVLXXXXXXSILAILTLLVGSVGGLLQIKIKRLLAFSGLTNAGYMMLLLLLNNNEFSYLYYITQYSISHLAIFMIIIXXXXXXXXXXXXXXXXXXXXXXXXXLVLSMAIVVFSFIGIPPLLGFFGKLNILMSILNNGYYFISIVLIVASLISALYYLYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADH-ubiquinone oxidoreductase chain 1
publication title Locking loop movement in the ubiquinone pocket of complex I disengages the proton pumps.
pubmed doi rcsb
total genus 126
structure length 434
sequence length 434
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2018-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00361 Proton_antipo_M Proton-conducting membrane transporter
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...