6HIWDQ

Cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete small mitoribosomal subunit in complex with mt-if-3
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
256
structure length
256
Chain Sequence
ERGLYFPINHRIVDHRIAPGVTVEETDVQSRYRRELRTNFATGETRQTIAPPWSARERPTHFFSLRLPSRNSVTLRVKEMHNHLLFSHQQCAPMLVSPTKLHITLGVMTIPENSREELVKNIQQSMSETFACVQPLQLRFRGLGTFDFGRVLFIRVVPEADFGRLERAVCDIRRRVGGVLGVDLKGNPHDSYVPHVTVAKIRPNQRQQLGDTIPQSLWADYQHHDFGDVTLSTVDLCRMKGSPDGYYHTEGAVHLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
pubmed doi rcsb
molecule keywords mS48
molecule tags Ribosome
total genus 58
structure length 256
sequence length 256
ec nomenclature
pdb deposition date 2018-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
DQ PF10469 AKAP7_NLS AKAP7 2'5' RNA ligase-like domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...