6HIWDR

Cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete small mitoribosomal subunit in complex with mt-if-3
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
261
structure length
251
Chain Sequence
SRRFRYNTKFPALVSYNKLPWEVVNHETPQFHMHVAPHYEQLLTLAASSPVPHIIGSKHIDVPREHRLRLLPGMLYLLDGDTLPGEFTINRVLDPTALQYYGRLSSQIVTVEAVRMLVPDDLRLLCNCITFKGPLHLPVAPYASLASLRGASSNCFTLYHFVRPNRPPKELQLEKYYIHAPCVAPLSEFASNSDERGNWRPRLQAPKRTRRATPLPAYRPPQSYLMGLAERLAVVPGGCFGRRSLMWGHWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords mS48
publication title Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
pubmed doi rcsb
total genus 32
structure length 251
sequence length 261
ec nomenclature
pdb deposition date 2018-08-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...