6HIWDS

Cryo-em structure of the trypanosoma brucei mitochondrial ribosome - this entry contains the complete small mitoribosomal subunit in complex with mt-if-3
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
245
structure length
238
Chain Sequence
SRWSSVWPNMRYGSMFLSYSVGRKLPMKGVNWVTRDSNRLLNFSNRYSAVISDIDVKRTEEELNVALSDIRWNDHRRIYWKCSFCGSSYRKNVSVRTKYHAGCNFCKKKYPSEVRGEQHGSPPVSQAAPELTEQLVDNGKRDNLATLAVTSKFYAEWTCRGCGGSYRSTIRSRTGQVEAGQCTLHPDIVAWSAYCPSCSWRPNMVPIAEEVSRSGQFLGLERSMEELGPIPRRKRLAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords mS48
publication title Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
pubmed doi rcsb
total genus 45
structure length 238
sequence length 245
ec nomenclature
pdb deposition date 2018-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
DS PF14311 DUF4379 Probable Zinc-ribbon domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...