6HQGA

Cytochrome p450-153 from phenylobacterium zucineum
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
419
structure length
363
Chain Sequence
DLQRAARDAAYSMPIEEINPADPELFRTDTMWPYFERLRKEDPVHWGVSPHEDVGGYWSVTKYNDIMAVDTNHEVFSSEPTIVLPDPADDFTLPMFIAMDPPKHDVQRKTVQPIVAPNHLAYLEPIIRERAGKILDDLPIGEEINWVDKVSIELTTMTLATLFDFPWNLRRQTLFECVDYFMRLWNEMEYLGNLILLIVGGNDTTRNTISGSVLALHQNPDQDRKLRENPGLIPAMVSETIRWQTPLAYMRRRAKRDFELGGKTIREGDKVAMWYVSGNRDEEVIDRPNDYWIERPRVRQHLSFGFGVHRCVGNRLAELQLKIIWEEILARFPRLEVVGPPRRVYSSFVKGYEELPVVIPTRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome P450
publication title The Extreme Structural Plasticity in the CYP153 Subfamily of P450s Directs Development of Designer Hydroxylases.
pubmed doi rcsb
source organism Phenylobacterium zucineum (strain hlk1)
total genus 126
structure length 363
sequence length 419
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2018-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00067 p450 Cytochrome P450
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...