6HQUA

Humanised rada mutant humrada22 in complex with a recombined brc repeat 8-2
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
229
structure length
208
Chain Sequence
TIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQLPPEEGGLNGSAMYIDTENTFRPERLREIAQNRGLDPDEVLDNVAYARAFNSNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTLAERQQKLARFLRMLHRLANEFDIAVFVTNQVQGHILAHSATLRVYLRKGKGGKRIARLIDGEAVFSITEKGIED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oncoprotein
molecule keywords DNA repair and recombination protein RadA
publication title Shuffled BRCA2 repeats with high affinity for a Rad51 surrogate: affinity maturation by modular recombination
rcsb
source organism Pyrococcus furiosus (strain atcc 43587 / dsm 3638 / jcm 8422 / vc1)
total genus 84
structure length 208
sequence length 229
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2018-09-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...