6I56A

Crystal structure of pbsx exported protein xepa
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
279
structure length
279
Chain Sequence
MVKYQYEFPLDKAGKAGAVKPYRGGKNDFVTPVSNLSGVAEILTNAALKATEAYSQLGQDRLGAVLISKVKGWAYADREGTLFIEESDNNNVWTTTAAVNVAAGVLTATDWVYLSKRYYRFRYVNGNLQQSEFVLYQSVGAGEMDVRVNEKTPLQIDFAENQTHDGRLKVEARKTFDFVFHENAESASEGAALPVDGAAHLLVEVYGTAEMSEVKFWGKSVSGQKLPIRGVKTDDATTASSTLGKAEAWAFDIKGFKEIIMEIISITGGTLSVKGTAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Phage-like element PBSX protein XepA
publication title Crystal structures of the Bacillus subtilis prophage lytic cassette proteins XepA and YomS.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 45
structure length 279
sequence length 279
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2018-11-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...