6I8VA

Ktrc with atp bound
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
216
structure length
216
Chain Sequence
KEFAVIGLGRFGGSICKALSEEGVEVMAMDIDEDKVNEYAKIASHAVIGDSTDESVLKNLGLRNFDHVIVAIGENIQASILTTLILKELGVHTITVKAQNDYHEKVLSKIGADHIVHPERDMAKRIAHNIVSNNVLDYLELSEEHSLVEIVANSRLAGNTLLDLDIRAKYGINIVAIKRGKEVIVSPLATEVIHQEDILIVIGSVTDISRFEKRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Ktr system potassium uptake protein C
publication title Characterization of the molecular properties of KtrC, a second RCK domain that regulates a Ktr channel in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 68
structure length 216
sequence length 216
ec nomenclature
pdb deposition date 2018-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02080 TrkA_C TrkA-C domain
A PF02254 TrkA_N TrkA-N domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...