6IREA

Complex structure of inad pdz45 and norpa cc-pbm
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
234
structure length
223
Chain Sequence
AEPPLVFEPVTLESLRQEAGFQAVGAAQIAELDTLRAAHAAERTSVQKTQNAAIDKLDIRNDANIKNSINDQTKQWTDMIARHRKEEWDMLRQHVQDSQDAMKALMLTVQAAQIKQLEDRHARDIKDLNAKQAKMSADTAKEVQNDKTNEKDRRLREKRQNNVKRFMEEKKQIGVKQGRAMEKLKLAHSKQIEEFSTDVQKLMDMYKIEEEAYKTQGKTEFYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/protein binding
molecule keywords 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase
publication title An unexpected INAD PDZ tandem-mediated plc beta binding inDrosophilaphoto receptors.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 97
structure length 223
sequence length 234
ec nomenclature ec 3.1.4.11: Phosphoinositide phospholipase C.
pdb deposition date 2018-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06631 DUF1154 Protein of unknown function (DUF1154)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...