6J1CA

Photoswitchable fluorescent protein gamillus, n150c/t204v double mutant, off-state
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
230
structure length
229
Chain Sequence
ASGRALFQYPMTSKIELNGEINGKKFKVAGEGFTPSSGRFNMHAYCTTGDLPMSWVVIASPLFHMFAHYPEDITHFFQECFPGSYTLDRTLRMEGDGTLTTHHEYSLEDGCVTSKTTLNASGFDPKGATMTKSFVKQLPCEVKITPHGPNGIRLTSTVLYLKEDGTIQIGTQDCIVTPVGGRKVTQPKAHFLHVQIIQKKDPNDTRDHIVQTELAVAGNLWHGMDELYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Fluorescent protein
molecule keywords Green fluorescent protein
publication title Acid-Tolerant Reversibly Switchable Green Fluorescent Protein for Super-resolution Imaging under Acidic Conditions.
pubmed doi rcsb
source organism Olindias
total genus 63
structure length 229
sequence length 230
ec nomenclature
pdb deposition date 2018-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...