6JMRE

Cd98hc extracellular domain bound to hbj127 fab and mem-108 fab
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
220
structure length
215
Chain Sequence
QVKLLESGPGLVQPSQSLSITCTVSGFSLTTYGIHWVRQPPGKGLEWLGVIWSNGRIDYNAAFISRLSITKDNSKSQVFFKMNSLQDDDTAIYYCARNVYDSLTWFTYWGQGTLVTVSAAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein/immune system
molecule keywords Antibody
publication title Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 215
sequence length 220
ec nomenclature
pdb deposition date 2019-03-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...