6JPQA

Cryoem structure of abo1 hexamer - adp complex
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
931
structure length
577
Chain Sequence
PLGVDSSLSFESVGGLDNYINQLKEMVMLPLLYPEIFQRFNMQPPRGVLFHGPPGTGKTLMARALAAACSSENKKVSFYMRKGADCLSKWVGEAERQLRLLFEEAKSTQPSIIFFDEIDGLAPVRSSKQEQIHASIVSTLLALMDGMESRGQVIIIGATNRPDAVDPALRRPGRFDREFYFPLPDRDARKKIIEIHTRNWDPPVPEWLCSMLAEKSKGYGGADLRALCTEAALNSIKRTYPQLYRSTKRLQIDPKTIKVKVKDFVMSMKRMIPSSERSSISPSKPLSPELKPLLNEAFQDIEKTLQKLMPVASKLNPLEEVMYDDPKENDFEYQQRLETFETLRIYKPRFLICGRKGLGQTALGPAILQQYEGVHVQSFDMSTLLQDSTQSIETSIIHLFLEVRRHTPSIIYIPDIDNWLNVLPLTAITTFSSMLERLDFSDQILFLALSSSPLSELHPQLREWFSSKQSVYSLQYPTRDSIIAFFQPILELIKASPTELPGGIPRKRRVLPELPLAPEDRLTPLKQLLIDSTTGFTVDQLLHLHSFLYQIIWNTKSEWNRNSVVDECERAVKEFMI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Uncharacterized AAA domain-containing protein C31G5.19
publication title Structural basis of nucleosome assembly by the Abo1 AAA+ ATPase histone chaperone.
pubmed doi rcsb
source organism Schizosaccharomyces pombe (strain 972 / atcc 24843)
total genus 136
structure length 577
sequence length 931
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2019-03-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...