6JQ3B

Crystal structure of h2-kb in complex with a dpagt1 mutant peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
96
structure length
90
Chain Sequence
IQKTPQIQVYSRHPNGKPNILNCYVTQFHPPHIEIQMGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTTDTYACRVKHASMAEPKTVYWD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, K-B alpha chain
publication title Crystal Structure of H2-Kb in complex with a DPAGT1 mutant peptide
rcsb
source organism Mus musculus
total genus 9
structure length 90
sequence length 96
ec nomenclature
pdb deposition date 2019-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...