6K33aK

Structure of psi-isia supercomplex from thermosynechococcus vulcanus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
59
structure length
43
Chain Sequence
VILSNLFAIALGRYAIQSRGGLPELLATTSFGHLLAAGVVSVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure of a cyanobacterial photosystem I surrounded by octadecameric IsiA antenna proteins.
pubmed doi rcsb
total genus 14
structure length 43
sequence length 59
chains with identical sequence bK, cK
ec nomenclature
pdb deposition date 2019-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
aK PF01241 PSI_PSAK Photosystem I psaG / psaK
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...