6KBWA

Crystal structure of tmm from myroides profundi d25
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
446
structure length
446
Chain Sequence
MLNLKVGIIGAGPSGLAMLRAFESEQKKGNPIPEIKCYEKQDNWGGMWNYTWRTGVGKYGEPIHGSMYKYLWSNGPKECLEFSDYTFMEHFKQPISSYPPREVLFDYIQGRIKQSNARDFIKFNTVARWVDYLEDKKQFRVIFDDLVKNETFEEYFDYLVVGTGHFSTPNMPYFKGIDSFPGTVMHAHDFRGADQFIDKDILLIGSSYSAEDIGVQCFKHGSKSVTISYRTNPIGAKWPKGIEEKPIVTHFEDNVAHFKDGSKKEYDAVILCTGYQHKFPFLPDNLRLKTKNNLYPDNLYKGVVFNENERLIFLGMQDQYYTFNMFDTQAWFARDYMLGRIALPNKEIRDKDIAKWVELEKTSVTGEEHVDFQTDYIKELIEMTDYPTFDLDRVAEMFKSWLNDKETNILNYRDKVYTSVMTGVTAEEHHTPWMKELDDSLERYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Flavoprotein
molecule keywords Trimethylamine monooxygenase
publication title Crystal structure of Tmm from Myroides profundi D25
rcsb
source organism Myroides profundi
total genus 161
structure length 446
sequence length 446
chains with identical sequence B
ec nomenclature
pdb deposition date 2019-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...