6KF3C

Cryo-em structure of thermococcus kodakarensis rna polymerase
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
388
structure length
388
Chain Sequence
VAEKTIKSMVSKAELPDNIKEELYAKLIEYNEKYKLKKDEIQAIIDETVREYQKALIEPGEAVGTVAAQSIGEPSTQMTLNTFHYAGVAEINVTLGLPRIIEIVDARKNPSTPIMTVYLDEEHRYDRDKALEVARRIEGTTLENLAREETIDILNMEYVVEIDPERLEKAGLDMEKVVRKLTGSFKSAEFEAEGYTLVVRPKKVTKLSDLRKIAEKVKKHRLKGLSGVGKTIIRKEGDEYVIYTEGSNFKQVLKVPGVDPTRTRTNNIWEIAEVLGIEAARNAIIDEIVSTMREQGLEVDVRHIMLVADMMTLDGVIRPIGRHGIVGEKASVLARAAFEITTQHLFAAAERGEVDPLNGVVENVLIGQPVPVGTGIVKLAMSLPLRPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit
publication title Cryo-EM structure of Thermococcus kodakarensis RNA polymerase
rcsb
source organism Thermococcus kodakarensis (strain atcc baa-918 / jcm 12380 / kod1)
total genus 42
structure length 388
sequence length 388
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2019-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...