6KKPA

The crystal structure of apo-siac from pseudomonas aeruginosa
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
123
structure length
121
Chain Sequence
MSDLHIPGTQSTPAIQGDWQAGRLSMQGDSYPENSYELFGQVIDWVERFLADGQRPLELDLRLLYLNTSSIKAMMDILDLLEEAHQGGRPVSLRWHYDRRNVAELAEEFREDCSFPFAIQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords DUF1987 domain-containing protein
publication title The SiaA/B/C/D signaling network regulates biofilm formation in Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 41
structure length 121
sequence length 123
ec nomenclature
pdb deposition date 2019-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09345 DUF1987 Domain of unknown function (DUF1987)
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...