6KL9B

Structure of lbcas12a-crrna complex bound to acrva4 (form a complex)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
117
structure length
117
Chain Sequence
HNDEMYLVVQALIRACIIKEIDLYTEQLYNIIKSLPYDKRPNVVYSDQPLDPNNLDLSEPELWAEQVGECMRYAHNDQPCFYIGSTKRELRVNYIVPVIGVRDEIERVMTLEEVRNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords LbCas12a
publication title Structural insight into multistage inhibition of CRISPR-Cas12a by AcrVA4.
pubmed doi rcsb
source organism Lachnospiraceae bacterium
total genus 17
structure length 117
sequence length 117
chains with identical sequence C
ec nomenclature
pdb deposition date 2019-07-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...