6KOGA

Ketosynthase domain in tenuazonic acid synthetase 1 (tas1).
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
458
structure length
436
Chain Sequence
NLYAIVGISCRFPGANTAEQLWNVLMEQRDAITTFCPAENLGFALEENSVFVPRYGMIDALKDFEPSAYSMSDAEAQTIDPQKRVFLDVAADALADAGTSASPGNPLDPVGVFVGAATNTFLSSRDNPGSEPQSFANHYQQLLDCPIGTFASFKLNLTGPVVTLNTACSSALAALHLACASLSHGDCNAAVVGGVSMAYPQEGGYVTARPGGDSSAVFSPSGVCHPLDSRADGCVPADGAAALVIKRLADARADGCRVYAVIEGVAVSADGSDDKAGLGVPSSSGQSRTVEAALRRAGPQALSRLRYVEMHGSGTPWGDALEVQGLKMAFDRLSKDRIYLGSNKGNCGNTEAASGLLSLIKASMALNLGVVPPLPNLAEPNPKCEFEETKFEPLGKQLALAPGDRVGVTSLGYGGSNAHVVLASAQLFGVEQKAFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Hybrid PKS-NRPS synthetase TAS1
publication title Unique features of the ketosynthase domain in a non-ribosomal peptide synthetase-polyketide synthase hybrid enzyme, tenuazonic acid synthetase 1.
pubmed doi rcsb
source organism Pyricularia oryzae 70-15
total genus 145
structure length 436
sequence length 458
chains with identical sequence B
ec nomenclature ec 2.3.1.-:
pdb deposition date 2019-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain
A PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...